KEGG   Felis catus (domestic cat): 101089877
Entry
101089877         CDS       T02385                                 
Symbol
TNFRSF14
Name
(RefSeq) tumor necrosis factor receptor superfamily member 14 isoform X1
  KO
K05152  tumor necrosis factor receptor superfamily member 14
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089877 (TNFRSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101089877 (TNFRSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101089877 (TNFRSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089877 (TNFRSF14)
   04090 CD molecules [BR:fca04090]
    101089877 (TNFRSF14)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101089877 (TNFRSF14)
CD molecules [BR:fca04090]
 Proteins
  101089877 (TNFRSF14)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101089877
NCBI-ProteinID: XP_006934293
Ensembl: ENSFCAG00000009522
LinkDB
Position
C1:1332441..1338699
AA seq 273 aa
MSLTLYLLLLGPLRCSLAAAPCKEEEYPVGAECCPKCGPGYRVQEACGELTGTLCVPCDP
GTYTAHLNGLSECLQCRVCDPAMGLVTRRQCSRTENTVCVCDQGHFCVSESGDDCAECRP
HTACRPGQRVQQRGTEWQDRVCEDCPPETFSPSGTLEECQPWTRRTRQGETLTGPAGPAG
RHHSGFGGDGIRVSREGPAHRSTALGGGRLRHLGLCPLEAARPPRADCGPSDSTQQRDTG
RRSGGSGTSHASHQLRGGPPPCHLCCPRVDPAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atgagcctgaccctgtacctgctcctcctggggcccctgcgctgctccttggccgcggcc
ccgtgcaaagaggaggagtatccggtaggggccgagtgctgcccgaagtgcggcccaggt
taccgggtgcaggaggcctgcggggagctgaccggcacgctgtgtgtcccctgtgacccg
gggacctacacggcccacctcaatggcctgagcgagtgtcttcagtgtcgtgtgtgtgac
ccagccatgggcctggtgaccaggcgacagtgctccagaacagagaacaccgtgtgcgtc
tgtgaccagggccacttctgcgttagtgagtcgggggacgactgtgcggagtgccgtccc
cacacggcctgcagacctggccagagggtacagcagagaggcaccgagtggcaggacagg
gtgtgtgaggactgccctccagagaccttctcgcccagtgggaccctggaggagtgccag
ccctggaccaggcggacccgccaaggggagactcttacaggtcccgcaggccccgccgga
cgtcaccacagtggctttggaggagacggcatccgtgtttcccgggagggaccagcccac
cgatcgacggctctaggaggcggacgtctgagacatctcgggctgtgcccgctcgaggcc
gccaggcccccgagggcagactgtgggccctcagactcgacgcagcagagggataccggc
cgccgctcagggggctcggggacctcacacgcctcccatcaacttcgcgggggcccgcct
ccctgccacctgtgctgtccacgtgtagacccagccctgtga

DBGET integrated database retrieval system