KEGG   Felis catus (domestic cat): 101090038
Entry
101090038         CDS       T02385                                 
Symbol
IL10RB
Name
(RefSeq) interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090038 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090038 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101090038 (IL10RB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090038 (IL10RB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101090038 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090038 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090038 (IL10RB)
   04090 CD molecules [BR:fca04090]
    101090038 (IL10RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101090038 (IL10RB)
CD molecules [BR:fca04090]
 Proteins
  101090038 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101090038
NCBI-ProteinID: XP_003991512
Ensembl: ENSFCAG00000012214
UniProt: M3WGI9
LinkDB
Position
C2:complement(12074186..12099393)
AA seq 371 aa
MARGLRSWLGGCLLVSALGMVPPPENVRMKSVNFKNVLQWEVPAFPKGNLTFTAQYQSYK
KFQDMCTSTVLMECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTMIGPPGMQV
EALANSLHMRFLAPKIENEPETWTMRNIYNSWAYNVQYWKNGSDEKWPITCQYDFEVLRD
LEPRTTYCVQVQGFLPDRNKTGEWSEPVCEPTTNAETAPSWTVAVVLAASVCVAFLLLGC
SALLWCLYKKTKHAFSPGNCLPQHLKEFLGCPHHNTLLFSFPPSDDNEVFDKLSVITPAS
ESSTQNPGNGCTPGTLSGQGSSRLVPEGEVHPAEYSTPLVLSPASEGKWSGKPPGQTPNL
DPEDSETTSEQ
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcgcggggcctgcggagctggctgggcggctgcctcctggtgtcagccttaggaatg
gtgccacctcccgaaaatgtgagaatgaagtcagtgaatttcaagaacgttctacagtgg
gaggtgcctgcttttcccaaagggaatctgactttcacagctcagtaccaaagttataag
aaattccaagatatgtgcacaagtactgtcttgatggaatgtgatttctcaagtctttcc
aagtatggtgatcacaccttgagagtcagggctgaatttgcagatgagcactcagactgg
gtgaacatcaccttctgtcctgtggatgacaccatgattggaccacctggaatgcaagta
gaagcacttgctaattctttacatatgcgtttcttagcccccaaaatagagaatgaacct
gaaacatggaccatgaggaatatttataactcgtgggcttataatgtgcaatattggaaa
aatggctctgacgaaaagtggccgattacttgtcagtatgactttgaggtcctcagagat
cttgagccacggacaacttactgtgttcaagttcaagggtttcttcctgatcggaacaaa
accggggaatggagcgagcctgtgtgtgagccaacaaccaatgccgagactgccccgtcc
tggactgtcgccgtcgtcctggccgcctcggtgtgtgtggccttcctgctcctcggctgc
tccgccctgctgtggtgcctgtacaagaagaccaagcacgccttctcccctgggaactgt
ctgcctcagcacctgaaagagtttttgggctgccctcatcacaatacacttctgttctcc
ttcccgccctctgatgacaatgaagtctttgacaaactgagcgtcattacgccagcctct
gaaagcagcacacagaatcctggcaacggctgtaccccggggaccctgtcagggcagggc
tcctccaggctggtccccgaaggggaagtgcacccagctgagtacagcacccccctggtt
ctctcgcctgcatctgagggtaaatggagcgggaaaccacctgggcaaaccccaaatctg
gatcccgaagattccgagacaacatctgaacaatga

DBGET integrated database retrieval system