KEGG   Felis catus (domestic cat): 101090075
Entry
101090075         CDS       T02385                                 
Symbol
ARHGEF7
Name
(RefSeq) rho guanine nucleotide exchange factor 7 isoform X5
  KO
K13710  Rho guanine nucleotide exchange factor 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101090075 (ARHGEF7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101090075 (ARHGEF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090075 (ARHGEF7)
Membrane trafficking [BR:fca04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101090075 (ARHGEF7)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF SH3_2 SH3_1 RhoGEF67_u1 SH3_9 PH TCTP GlutR_dimer
Other DBs
NCBI-GeneID: 101090075
NCBI-ProteinID: XP_003980580
Ensembl: ENSFCAG00000014533
LinkDB
Position
A1:80813869..80947740
AA seq 780 aa
MKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGAQPSH
SRTSKLFQGQYRSLDMTDNSNSQLVVRAKFNFQQTNEDELSFTKGDIIHVTRVEEGGWWE
GTHNGRTGWFPSNYVREVKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETE
NEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQ
QRVGGCFLNLMPQMKTLYLAYCANHPSAVNVLTEHSEQLGEFMETRGASSPGILVLTTGL
SRPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILT
EAIRSWEGDDITTLGSVVYMSQVMVQCAGSEEKNERYLLLFPNSLLMLSASPRMSGFIYQ
GKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVDHLQKQTKVTSVG
NPTIKPHSVPSHTLPSHPIAPSGKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEP
PKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFALRKS
TAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGRRSSLS
RLEPSDLSEDSDYDSIWTAHSYRMGSTSRSRKESAPQVLLPEEEKIIVEETKSNGQTVIE
EKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaagacatttgatgcaaatgatttgtatcaggggcagaattttaacaaggtcctcagt
tccttagtgactctaaacaaagtaacagcagacatcggcctgggaagtgactccgtgtgt
gcccggccctcatctcatcggataaagtcttttgactccctgggagcccagccttcgcac
agtcggacttcaaaattgttccagggccagtatcgaagtttggacatgaccgataatagc
aacagccaactggtggtgagagcgaagtttaacttccagcagaccaatgaagatgagctc
tcctttacgaaaggcgacatcatccacgtcacgcgggtcgaggagggcggctggtgggag
ggcacgcacaatggcaggaccggctggtttcccagcaactacgtgcgggaggtcaagccc
agtgaaaagcccgtgtctcctaaatcaggaacgttgaagagccctcccaaaggatttgat
actactgccattaacaagagctattacaacgtggtgctacagaatattttggaaactgaa
aatgagtattctaaagaacttcagactgtgctttctacctacctgcggcctttgcagacc
agcgagaagttaagttcagcaaacatttcatatttaatgggaaatctagaagagatatgt
tctttccagcaaatgcttgtacagtctttagaagaatgcaccaagttgccagaagctcag
cagagagttggaggatgctttttaaatctgatgccacagatgaaaaccttgtaccttgcg
tattgtgccaaccacccgtctgcagtgaacgttctcacggagcacagcgagcagctggga
gagttcatggagaccagaggcgccagcagcccggggatcctggtgctgaccaccggcctc
agcagaccgttcatgcgcctggacaagtaccccacgttgctcaaggagctggagagacac
atggaggattatcatccagatagacaagatattcaaaaatccatgactgccttcaaaaac
ctctcagcgcagtgtcaggaggtgcggaaaaggaaggagctggagttgcagatcctgaca
gaagccatccggagctgggagggagatgacatcacgaccctgggcagcgtcgtttacatg
tcccaggtcatggtccagtgcgccgggagtgaggaaaagaatgagagataccttctgctc
ttcccaaatagtttgctgatgttatctgccagtcctaggatgagtggttttatctatcag
ggaaagctaccaacgacaggaatgacaatcacaaagcttgaggacagtgaaaatcataga
aatgcatttgaaatatcagggagcatgattgagcggatcctcgtgtcctgcaacaaccag
caggatctgcacgagtgggtggaccatctccagaagcagacaaaggtcacctctgtcggc
aaccccaccatcaagccccattctgtgccgtctcacaccctcccctctcatccgatcgcg
ccatccggcaagcacgcagacagcaagccggcacccctgacgcctgcctaccacacgctg
ccccacccctcccatcacggcactccgcacaccaccatcaactgggggcctctggagcct
ccgaagacccccaagccgtggagcctcagctgcctgcgacctgccccgcccctgcggcct
tccgctgctctctgctacaaggaggatcttagtaagagtcccaagaccatgaaaaagttg
ctacctaagcgcaagcctgagcggaagccttcagatgaagagttcgccctgaggaaaagc
acagctgctttggaagaagacgcgcagatcctgaaagtcatcgaagcttattgcacaagc
gccaaaacgcggcaaacgctcaattcgacatggcaaggcactgacctgatgcataatcac
gtcttggctgacgacgaccaatcaagtctagactccttgggtcgtcgcagtagcctttcc
cgtttggagccctcagacctctcggaagactctgactatgacagtatatggacagcccat
agttacagaatgggttctacatctcgctcacgcaaagaatctgctccacaagttttgctt
ccagaggaagagaaaatcatagttgaagaaactaagagtaatggtcagacagtgatagaa
gaaaagagtcttgtggatactgtctacgcgttaaaggacgaagtccaagagttaagacag
gataacaaaaagatgaagaaatctctggaggaagagcagagagcccgcaaggacctggaa
aagctggtgaggaaagttctgaagaacatgaacgaccctgcctgggatgagaccaacctc
tga

DBGET integrated database retrieval system