KEGG   Felis catus (domestic cat): 101090171
Entry
101090171         CDS       T02385                                 
Symbol
TYK2
Name
(RefSeq) non-receptor tyrosine-protein kinase TYK2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090171 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090171 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101090171 (TYK2)
   04658 Th1 and Th2 cell differentiation
    101090171 (TYK2)
   04659 Th17 cell differentiation
    101090171 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101090171 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101090171 (TYK2)
   05160 Hepatitis C
    101090171 (TYK2)
   05171 Coronavirus disease - COVID-19
    101090171 (TYK2)
   05164 Influenza A
    101090171 (TYK2)
   05162 Measles
    101090171 (TYK2)
   05168 Herpes simplex virus 1 infection
    101090171 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090171 (TYK2)
   05169 Epstein-Barr virus infection
    101090171 (TYK2)
   05165 Human papillomavirus infection
    101090171 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090171 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090171 (TYK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101090171 (TYK2)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101090171 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH ABC1 RIO1
Other DBs
NCBI-GeneID: 101090171
NCBI-ProteinID: XP_023101019
Ensembl: ENSFCAG00000009436
LinkDB
Position
A2:complement(7846299..7864550)
AA seq 1194 aa
MACLFPAKPAVKSMPLCRWGATTMDSRTDGDEAQPMVSRGGLKVLLHWAGPDGGDPWVTF
SEATLTAEEVCIHIAHKVGITPSCLNLFALFDAQAQVWLPPNHILEVSRDTNLTLYFRMR
FYFRNWHSMNPQEPAVYRCGPTRAKSSSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVAP
LWELSSEEEIHHFKNESLGMAFLHLCHLALCHGIPLEKVAKKISFKDCIPRSFRLQLRRH
NALTRLRLRRLFRRFVRAFQPGHVSQPVIMVKYLATLEQLAPRFGTERVLVCRLEEQAQA
VGDPCYVQDGGQSPPEPGPELAPGPPTHEVLVTGTGGIRWRPVQAEGPGGDGCSRNPCAG
PSGKKSKAQEVGNQPVDRPQEAPWAYFCDFQDITHVVLKERHVSIHCQDKCLELTLPSRA
VALSLVSLVDGYFRLTADSSHYLCREVAPPRLVMSIRDGIHGPLLEPFVLAKLRPEDGLY
LIHWSTSHLNRLILTVAQRDQAPGGQQLHLRKFPIELRAGSFELEGWDRSFPSVRELRTA
LQGCSLRAGDDCFSLRRCCLPRPGELSNLIIMRGSRASPGPLNLSQLSFHRVCQDDITQL
SHLGQGTRTNVYEGILRVGERGPKEGTADGGDPPTPSGDRGQELRVVLKVLDPSHHDIAL
AFYETASLMSQVSHVHLAFVHGVCVHGSENIMVTEYVEHGPLDVWLRRERGHVPVAWKVA
VAQQLASALSYLEDKSLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERV
ERIPWTAPECLSGGASTLTTAADKWGFGVTLLEICFDGEAPLQGRGPSEKECFYQKQHQL
PQPSCPELATLTSQCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFH
KRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKAGGGPQLRTGWRREIDILRT
LYHKHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHNVGLAQLLLFAQQICEGMAY
LHAQHYVHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECL
KECKFYYASDVWSFGVTMYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGER
LPRPEKCPCEIYLLMKNCWEAEASFRPTFQNLIPILKTVQEKYQGQAASVFNVC
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggcctgtctcttcccagccaagccagctgtcaagagcatgcctctgtgccgttggggt
gccaccaccatggacagcaggactgatggggatgaggctcagcccatggtctccagggga
ggcctaaaggtccttctgcactgggctggccctgatggcggggacccttgggtcaccttc
agcgaggccacactgaccgcagaggaggtctgcatccacatcgcacacaaagtcggcatc
actccatcctgcctcaatctcttcgccctctttgatgcccaggcccaggtgtggctgccc
ccaaaccacatcttggaggtctccagagacacgaacctgacattgtacttccgcatgagg
ttttatttccggaactggcacagcatgaatcctcaggagccggccgtgtaccgctgtggg
cccaccagggccaagtcttcctcggaacaggcagagcagggggtgcaactcctggaccca
gcctcctttgagtacctctttgagcagggcaagcacgagtttgtgaatgatgtggcacca
ctgtgggagctgtcgagcgaggaggagatccaccattttaagaacgagagcctgggcatg
gcctttctgcacctctgccacctcgccctttgccatggtatccccctggagaaggtggcc
aagaagatcagcttcaaggactgcatcccacgctccttccggctgcagctccggcggcac
aacgcgttaacacggctgcgcctacggagactcttccgcaggtttgtgcgggccttccag
ccgggccacgtctcccagccggtcatcatggtcaagtacctggccacgctggagcagctg
gcaccccgcttcggcacggagcgcgtgctcgtgtgccggctggaggagcaggcccaggcc
gtgggggacccctgctacgtccaggacgggggccagtcccccccggagcctgggcctgaa
ttggcccccggaccccctactcatgaggtgctggtgacaggcactggtggcatccggtgg
cggccagtccaggcagagggtcccgggggcgatggttgcagcaggaacccctgtgctggc
ccatcagggaagaaaagcaaggcccaggaggtgggcaaccagccagtggacaggcctcag
gaagcgccatgggcctacttctgtgacttccaggacatcacccacgtggtgctgaaagag
cgccacgtcagcatccactgtcaggacaagtgcctggagctcaccctgccttcccgggct
gtggccctgtccttggtgtcgctggtggacggctatttccgcctgacggccgactcgagc
cactacctgtgccgggaggtggcccctccgcggctggtgatgagcatccgggatggcatc
cacgggcccttgctggagccattcgtgctggccaagttgcggcccgaagatggcctctac
ctcatccactggagcaccagccacctcaaccgtctcatcctcacggtggcccagcgtgac
caggcacctggcgggcagcagctgcacctccgtaaattccctattgagctgcgggccggg
agcttcgagctggagggctgggaccgctccttcccgagcgtgcgggagctgcgcaccgcc
ctgcagggctgctcgctgcgggccggggacgactgtttctccctgcgccgctgctgcctg
ccacggcccggagagctctccaacctcatcatcatgcgtgggtctcgggccagccctggg
ccactcaacctcagccagctcagcttccaccgcgtctgccaggatgacattacccagctg
tctcacttgggccaaggcacgaggaccaatgtgtatgagggcatcttacgggtgggggaa
agaggccccaaggagggcacggcagatggtggggatccccccacgcccagtggggaccgt
gggcaggagctccgagtggtactcaaggtgctggaccccagtcaccacgacatcgccctg
gccttctacgagacagccagcctcatgagccaggtctcccacgtgcacctggcctttgtg
cacggcgtctgcgtgcacggctctgagaacatcatggtgacagagtacgtggagcacgga
cccctggatgtgtggctgcggcgggagaggggccacgtgcctgtggcctggaaggtggca
gtggcccagcagctggccagcgctctcagctacctggaagacaagagcctggttcatggt
aatgtgtgtggccggaacatcctgctggcacggctgggactggcggagggcaccagcccc
ttcatcaagctgagcgatcccggtgtgggcctgggcgccctttccagggaggagcgggta
gagaggatcccctggacagcccccgagtgcctgtcaggtggggccagcaccctaaccact
gcagctgacaaatggggctttggtgtcaccctcctggagatctgcttcgacggggaggcc
cctctgcagggccgcggcccttctgagaaagagtgcttctaccagaagcagcaccagctt
cctcagccctcctgcccggagctggccacactcaccagccagtgcctgacctatgaacca
gctcagcggccctccttccgcaccatcctgcgtgacctcactcagctgcagccccagaat
cttgctgacgtcttggctgtgaaccccgactcgcctgcatcagaccccaccgttttccac
aagcgctatttgaaaaagatccgggatctgggcgagggtcatttcggcaaggtcagtctg
tattgctacgacccgactaacgacggcaccggcgagatggtggctgtgaaggccctcaag
gcgggcgggggcccccagctccgcactggctggcggcgggagatcgacatcctgcgcacg
ctctaccacaagcacatcgtcaaatacaagggatgctgtgaggaccaaggagagaagtcg
gtgcagctcgttatggagtacgtgcctctgggcagcctccgggactaccttccccggcac
aacgtcggactggcccaactgctactcttcgcccagcagatctgtgagggcatggcctac
cttcatgcacagcactacgtccaccgagacctggctgcccgcaacgtgctgctggacaac
gacaggctggtcaaaatcggggactttggcctagccaaggctgtgcctgaaggccatgag
tactaccgcgtgcgcgaagatggggacagccccgtgttctggtatgctccagagtgcctg
aaggagtgtaagttctactatgcatccgacgtctggtccttcggggtcaccatgtatgag
ctgctgacctactgtgactccagccagagccccccttcgaaattcatcgagctcataggc
ctcacccaagggcagatgacggtgctgaggctcactgagctgctggaacgaggggagagg
ctgccgcggccagagaaatgcccttgcgagatctacctcctcatgaagaactgctgggag
gcagaggcctcattccgccccactttccagaacctcatccccattctcaagacggtccag
gagaaataccaaggccaggccgcctcagtgttcaatgtgtgctga

DBGET integrated database retrieval system