KEGG   Felis catus (domestic cat): 101090260
Entry
101090260         CDS       T02385                                 
Symbol
KDR
Name
(RefSeq) vascular endothelial growth factor receptor 2
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca05205  Proteoglycans in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090260 (KDR)
   04014 Ras signaling pathway
    101090260 (KDR)
   04015 Rap1 signaling pathway
    101090260 (KDR)
   04370 VEGF signaling pathway
    101090260 (KDR)
   04020 Calcium signaling pathway
    101090260 (KDR)
   04151 PI3K-Akt signaling pathway
    101090260 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090260 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101090260 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101090260 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101090260 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090260 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101090260 (KDR)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101090260 (KDR)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   101090260 (KDR)
CD molecules [BR:fca04090]
 Proteins
  101090260 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_4 Haspin_kinase
Other DBs
NCBI-GeneID: 101090260
NCBI-ProteinID: XP_011280181
Ensembl: ENSFCAG00000009679
LinkDB
Position
B1:163648853..163695555
AA seq 1356 aa
MESKALLAVVLWFCVETGAASVGLPSVSLDPPRLSIQKDILTIMANTTLQITCRGQRDLD
WLWPNNQSGSEKRVEVTDCSDSFFCKTLTIPKVIGNDTGAYKCFYQDTDVASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYKIYDVVLSPPHGVELSVGE
RLVLNCTARTELNVGIDFNWEYPSLKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGWYTCAASSGLMTKRNSTFVRVHEKPFVAFGSGMESLVEAIVGDRVRVPVKYLGYPSP
EIKWYKNGRPIESNHTIKVGHVLTIMEVSEKDTGNYTVILTNPISKEKQSHVVSLVVNVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAVPPPHHIRWYWQLEEECAYRPAQAVLMTNPY
TCKEWRNVDDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKAGRGE
RVISFHVTRGPEITLQPGTQPTEQERVSLWCTADRTTFENLTWYKAGSQALPVHVGELPT
PICKNLDALWKMNATTFSNGTSDTLILELQNASLQDQGDYVCFAQDRKTKKRHCVVRQLM
VLERVAPMITGNLENQTTSIGETIEVSCTTSGNPPPQITWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIVEGAQEKTNLEVIILVGTAVIAMFFWL
LLVIVLRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKEYVGEITMDPK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEVSEDLYKNFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLAPSFSGLMPSKSKESVASEGSNHTSGYQSGYHSDDTDTAVYS
SEEAELLKLVEIGPQAGSAAQILQPDSGPALGSPPV
NT seq 4071 nt   +upstreamnt  +downstreamnt
atggagagcaaggcgctgctggccgtcgttctgtggttctgcgtggagaccggggctgcc
tctgtgggtttgcctagtgtttcccttgatccacccagactcagcatacaaaaagacata
cttacaattatggctaatacaactcttcagattacttgcaggggacagagggacttggac
tggctctggcccaacaatcagagtggctctgagaagagagtggaggtgacggactgcagt
gacagcttcttctgtaagacgctcacgattccaaaagtgatcggaaatgatactggagcc
tacaagtgcttctaccaggacactgacgtagcctcggtcatttatgtctatgttcaagat
tacaggtctccatttattgcttctgttagcgaccaacatggcgttgtgtacatcactgag
aacaaaaacaaaactgtcgtgattccatgtcttgggtccatttccaacctcaatgtgtca
ctttgtgcaaggtatccagaaaagaggtttgtccctgatggtaacagaatttcctgggac
agtaagaaaggctttactatccccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtggttgtaggg
tacaagatttatgatgtggttctgagcccccctcatggagttgagctgtctgttggagag
aggctcgtcttaaactgtacagcgaggactgaactaaatgtggggattgacttcaactgg
gaatacccttctttgaagcatcagcataaaaagcttgttaaccgggacctaaaaactcaa
tctgggagtgagatgaagaaatttttgagcaccttgaccatagatggtgtaacccggagt
gaccaagggtggtatacctgtgcggcttccagtgggctgatgaccaagcggaacagcacg
ttcgtcagggtccacgaaaaaccttttgtcgcttttggtagtggcatggaatctttggtg
gaagccatcgtgggagaccgtgtcagagtgcctgtgaagtaccttggttacccttccccg
gaaataaaatggtataaaaatggaagacccattgagtccaatcacacaataaaagtgggg
catgtactgactattatggaagtgagtgaaaaagatacaggaaattacactgtcatcctt
accaaccccatttcgaaggagaagcagagccacgtggtatctctggtcgtgaatgtccca
ccccagatcggcgagaaatccctgatctctccggtggattcgtaccagtacggcaccacg
caaacgctgacgtgcacggtctacgcggtccccccgccacatcacatccgctggtactgg
cagctggaggaggagtgtgcctacaggcctgcccaagctgtcttaatgacaaacccatac
acttgtaaagaatggaggaatgtggatgacttccaggggggaaataaaattgaagtcaac
aaaaatcaatttgccctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagccgtcaacaaagctgggagaggagag
agggttatctccttccacgtgaccaggggccctgaaatcactttgcagcccggcacccag
ccgaccgaacaggaacgggtatctttgtggtgcactgcagacagaactacgtttgagaac
ctcacgtggtacaaggctggctctcaggctctgccagtccatgtgggagagctgcctaca
cccatctgcaagaacttggatgccctttggaaaatgaatgccaccacgttctctaatggc
acaagcgacactttgatcctggagctccagaatgcatccttgcaggaccaaggagattat
gtgtgctttgctcaggacaggaagaccaagaaaaggcattgtgtggtccgacagctcatg
gttttagagcgtgtggcacccatgatcacaggaaacctggagaatcaaacaacaagtatt
ggtgaaaccatcgaagtttcgtgcaccacgtctgggaatccccctccacagattacgtgg
tttaaagataatgaaacacttgttgaagactcaggtattgtactgaaagatgggaaccgg
aacctaaccatccgcagggtgaggaaggaagatgaaggcctgtatacctgccaggcatgc
agtgttcttgggtgtgcaaaagtggaggcatttttcatcgtagaaggtgcccaggagaag
acgaacttggaggtcattattctagtaggcacagcagtgattgccatgttcttctggtta
ttacttgtcatcgttctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactgcccttggacgaacactgtgaacgtttg
ccttatgatgccagcaagtgggaatttcccagagaccggctgaaactaggtaagcccctt
ggccgtggtgcctttggccaagtgatcgaagcagatgcctttggaattgacaagacagcg
acttgcaagacagtggctgtcaaaatgttaaaagaaggagccacacacagtgaacaccga
gccctcatgtctgaactcaagatcctcattcatattggccaccatctcaatgtggtcaat
cttctaggtgcctgtaccaagccaggagggccactcatggtgatcgtggaattttgcaag
tttggaaacctgtcaacttacttaaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgatttcgtcaagggaaggaatacgttggggaaatcactatggatccgaaa
cgccgtttggatagtatcacgagtagtcagagctcagccagctctggatttgttgaggag
aaatccctcagtgatgtggaggaagaggaagtttctgaagatctgtacaagaacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagtttttggcg
tcacggaagtgtatccacagggacctggcggcacgaaatatcctcttgtcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagacccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgaccga
gtgtacacaattcagagtgatgtgtggtcttttggtgttttgctctgggaaatattttcc
ttaggtgcttctccatatcctggagtaaagattgatgaggaattttgtaggcgattgaaa
gaaggcactagaatgagggcccctgattataccacaccagaaatgtaccagaccatgctt
gactgctggcatggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctgttacaagctaatgctcagcaggatggcaaagactatattgttctcccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaagaggaagtgtgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcccgtgagtgtaaaaacatttgaa
gatatcccgttggaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcatcagaagagctgaaaaccttggaagacagaaccaaattagctcca
tcttttagtggcctgatgcccagcaaaagcaaggagtccgtggcatccgaaggctcaaac
cacacgagtggctaccagtccgggtatcactcggacgacacagacaccgctgtgtactcc
agcgaggaggcagaacttttaaagctggtggagattggaccacaagctggcagtgcagcc
cagattctccagcctgactctggacccgcgttgggctctcctcctgtttaa

DBGET integrated database retrieval system