KEGG   Felis catus (domestic cat): 101090324
Entry
101090324         CDS       T02385                                 
Name
(RefSeq) TIR domain-containing adapter molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca05133  Pertussis
fca05161  Hepatitis B
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101090324
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090324
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101090324
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101090324
  09172 Infectious disease: viral
   05161 Hepatitis B
    101090324
  09171 Infectious disease: bacterial
   05133 Pertussis
    101090324
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101090324
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 101090324
NCBI-ProteinID: XP_006927597
LinkDB
Position
A1:complement(96343562..96359966)
AA seq 237 aa
MLIMGVGKSKIDPCPLSLPWGKSPSVDMSQRPHEADSKKSDDISLRDIAEHSHGALTPSG
EQEGTEATEEVPEEDEEEVFLKFVILHAEDDTDEALRVQNLLQNDFGIKPGIIFAEMPCG
RQHLQNLDDAVNGSAWTILLLTENFLRDTWCKFQFYTSLMNSVNRQHKYNSVIPLRPLNN
PLPRERTPFALRTINALEEESRGFPTQVERIFQESVYKIQQSIWKETRTTLQRQSIA
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttgataatgggtgtcgggaagtctaaaatagacccctgccctctctctctgccctgg
ggtaaaagtcccagtgtggatatgagtcagagacctcatgaggcagattccaagaaatcc
gacgacatctccctgcgtgacattgccgagcatagccacggtgccctgacaccctctgga
gagcaggagggcactgaggccacagaagaggtgcccgaagaggatgaagaggaggtgttc
ctcaagtttgtgatactgcacgcagaagatgacacagacgaggccctcagagtccagaat
ctgctacaaaatgacttcggcatcaaacccggaataatcttcgccgagatgccgtgcggc
agacagcacctgcagaacctagacgacgccgtaaacgggtctgcctggaccatcttactg
ttgaccgaaaactttttaagagacacctggtgtaaattccagttctacacgtccctcatg
aactccgtgaacaggcagcacaagtacaactccgtcatacccctgcggcccctgaataat
cccctgccccgagaaaggactccctttgctctgcgaaccatcaatgccctagaggaagaa
agccgtggctttcctacacaagtggaaaggattttccaggagtctgtgtataagatacaa
caatctatatggaaagagaccagaactaccctgcagaggcaatcgatcgcctga

DBGET integrated database retrieval system