KEGG   Felis catus (domestic cat): 101090500
Entry
101090500         CDS       T02385                                 
Symbol
IRAK1
Name
(RefSeq) interleukin-1 receptor-associated kinase 1 isoform X1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090500 (IRAK1)
   04064 NF-kappa B signaling pathway
    101090500 (IRAK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101090500 (IRAK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101090500 (IRAK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101090500 (IRAK1)
   05161 Hepatitis B
    101090500 (IRAK1)
   05171 Coronavirus disease - COVID-19
    101090500 (IRAK1)
   05162 Measles
    101090500 (IRAK1)
   05168 Herpes simplex virus 1 infection
    101090500 (IRAK1)
   05169 Epstein-Barr virus infection
    101090500 (IRAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101090500 (IRAK1)
   05135 Yersinia infection
    101090500 (IRAK1)
   05133 Pertussis
    101090500 (IRAK1)
   05152 Tuberculosis
    101090500 (IRAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090500 (IRAK1)
   05140 Leishmaniasis
    101090500 (IRAK1)
   05142 Chagas disease
    101090500 (IRAK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101090500 (IRAK1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101090500 (IRAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090500 (IRAK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101090500 (IRAK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101090500 (IRAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death APH Seadorna_VP7 RAMP
Other DBs
NCBI-GeneID: 101090500
NCBI-ProteinID: XP_023104699
Ensembl: ENSFCAG00000010847
LinkDB
Position
X:complement(128996227..129005192)
AA seq 724 aa
MAGGPGPGDPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVRILTHLQLLRARDIITAWHPPAPLLPPGTSTPRPSS
PPAPSEAEALRPRKLQTSASTLPSPVFPGSQTHSGAELGPVPSPAALQPPSPYPDPSSTK
PNRESPVSLLQGAHPSPFCWPLTEISQGTHNFSEELKIGEGGFGCVYRAVMRNTLYAVKR
LKEGADLEWTTVRQSFLTEVEQLSRFRHPNIVDFAGYCAESGFYCLVYGFLPSGSLEDRL
HFQACPPLSWPQRLNILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDDRLMPKLGDFGLA
RLSRFAAASPGQSSTVARTRTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQR
AVRTHGTKTKYLKDLVEEEAEEAGLALKSTQTTLQAGLAADAWAAPIAAQICKKHLDPRP
GPCPPKLGLALGQLACCCLHRRAKRRPPMTQVYESLERLQAAVAGPALEHEAAGHGPPSP
QENSYISTAGSAPSAAGPLRPLAVPPGAPAPAPDWLQKGPNQPVESDESVSGLSAALHSW
HLSPSCPPGLALPGSPGQGAAVWAPASLGTAGGTEGGATQASSWGSGPGPRLTAMEGPLL
GSSLSSQPPQIVINPARQKMVQKLALYEDGVLDSLQLLSSSSLPGLGVERQNRQGPEESD
EFQS
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggccggtgggccgggcccgggggaccccgcggcccccggcgcccagcacttcttgtac
gaggtgccgccttgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagtgtcctgtggccctggatcaaccgcaacgcccgcgtg
gccgacctcgtgcgcatcctcacgcacctgcagctgctccgcgcgcgggatatcatcacg
gcctggcaccctcccgccccccttctgccccccggcaccagcaccccgaggcccagcagc
ccccctgcaccctctgaggccgaggccctccgcccccggaagttgcagacgtcagcctcc
acactcccctccccagtttttccaggctcccaaacccattctggggctgagctgggtcct
gtcccaagccctgctgccctccagccaccatcaccatatccagacccttcctctaccaag
cctaaccgggagagcccagtgtccctcctgcagggggcccacccctctccgttctgctgg
cccctcactgagatttcccaaggcacccacaacttctcagaggagctgaagatcggggag
ggcggcttcgggtgtgtgtaccgggctgtgatgaggaacacgctgtatgctgtgaagagg
ctgaaggagggggcagacctggagtggaccacagtgaggcagagcttcctgaccgaagtg
gaacagctgtctcggtttcgtcacccaaacatcgtggactttgccggctactgcgccgag
agtggcttctactgcctcgtctatggcttcctgcccagtggctccctggaagaccgcctc
cacttccaggcctgcccccctctctcctggcctcagcgactaaacatcctcctgggcacg
gcacgggcgattcagtttctacatcaggacagccccagcctcatccacggagacatcaag
agctccaacgtccttctggatgacagactgatgcccaaactgggagactttggcctggcg
cgtctcagccgcttcgccgcggccagtcccggccagagcagcaccgtggcccggacgcgg
accgtgcgtggcactctggcctacctgcccgaggagtacatcaagacggggcggctggcc
gtggacaccgacaccttcagcttcggcgtggtagtgctggagaccctggctggccagagg
gccgtgaggacgcatggtaccaagaccaagtatctgaaagacctggttgaagaagaggct
gaggaggccgggttagccctgaaaagcacccagaccacactccaagcaggtctggccgca
gacgcctgggctgccccaattgccgcccagatctgtaagaagcatctggacccccggccc
gggccgtgcccccccaagctgggcctggcgctgggccagctggcttgctgctgtctgcac
cggcgggccaaaaggagaccccccatgacccaggtgtatgagagcctggagaggctgcag
gcggccgtggcggggccagcgctggagcatgaggctgccggccacggccccccttccccc
caggagaactcctacatctccacggccggcagcgccccaagcgctgccggcccgctgcgg
cccctggcggttcccccaggagccccagccccggctccagactggctccagaagggcccc
aaccagcccgtggagagtgacgagagcgtgtccggcctgtctgctgccctgcattcctgg
cacctgagcccgagctgccccccaggcctggccttgcccggcagccccgggcaaggtgcc
gccgtgtgggccccggcatccctcgggacggccggcggtaccgaagggggagccacccaa
gcgtcgagctgggggagcggcccagggccccggctgacagctatggaaggaccgctcttg
ggtagctctctgtcatcacagccaccacagatcgtcatcaacccagcccggcagaagatg
gtgcagaagctggccttgtatgaggacggggtcctggacagcctacagctgctgtcgtcc
agctcactcccaggcttaggcgtggagcgccaaaacaggcaggggccagaagagagcgac
gaatttcagagttga

DBGET integrated database retrieval system