KEGG   Felis catus (domestic cat): 101090622
Entry
101090622         CDS       T02385                                 
Symbol
NFKBIA
Name
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05134  Legionellosis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101090622 (NFKBIA)
   04668 TNF signaling pathway
    101090622 (NFKBIA)
   04024 cAMP signaling pathway
    101090622 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101090622 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101090622 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    101090622 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    101090622 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    101090622 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    101090622 (NFKBIA)
   04660 T cell receptor signaling pathway
    101090622 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    101090622 (NFKBIA)
   04659 Th17 cell differentiation
    101090622 (NFKBIA)
   04657 IL-17 signaling pathway
    101090622 (NFKBIA)
   04662 B cell receptor signaling pathway
    101090622 (NFKBIA)
   04062 Chemokine signaling pathway
    101090622 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101090622 (NFKBIA)
   04926 Relaxin signaling pathway
    101090622 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101090622 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101090622 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090622 (NFKBIA)
   05208 Chemical carcinogenesis - reactive oxygen species
    101090622 (NFKBIA)
   05203 Viral carcinogenesis
    101090622 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101090622 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101090622 (NFKBIA)
   05215 Prostate cancer
    101090622 (NFKBIA)
   05222 Small cell lung cancer
    101090622 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090622 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    101090622 (NFKBIA)
   05161 Hepatitis B
    101090622 (NFKBIA)
   05160 Hepatitis C
    101090622 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    101090622 (NFKBIA)
   05164 Influenza A
    101090622 (NFKBIA)
   05162 Measles
    101090622 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    101090622 (NFKBIA)
   05163 Human cytomegalovirus infection
    101090622 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090622 (NFKBIA)
   05169 Epstein-Barr virus infection
    101090622 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101090622 (NFKBIA)
   05135 Yersinia infection
    101090622 (NFKBIA)
   05134 Legionellosis
    101090622 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090622 (NFKBIA)
   05140 Leishmaniasis
    101090622 (NFKBIA)
   05142 Chagas disease
    101090622 (NFKBIA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101090622 (NFKBIA)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101090622 (NFKBIA)
   04931 Insulin resistance
    101090622 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101090622 (NFKBIA)
   04131 Membrane trafficking [BR:fca04131]
    101090622 (NFKBIA)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101090622 (NFKBIA)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101090622 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 101090622
NCBI-ProteinID: XP_003987591
Ensembl: ENSFCAG00000006671
UniProt: M3W6B3
LinkDB
Position
B3:complement(86921071..86924350)
AA seq 314 aa
MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGTEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcaacccgccgagcacgcccaggactgggccatggagggtccccgggacgcgctc
aagaaagagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccggcttgagccccaggaggcgccg
cgcggcaccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcattgaccatggaagtagtccgccaagtgaaaggagac
ctggccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg
ggagtcctgactcagacctgcaggacccagcacctctactccatcttgcaggccaccaac
tacaatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgcc
ctccaccttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgcggg
gctgatgtcaacagagtcacctaccaaggctactccccttaccagctcacctggggccgt
ccaagtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccagagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctg
ccctatgatgactgtgtgcttggaggccaacgcctgacgttatga

KEGG   Felis catus (domestic cat): 101096065
Entry
101096065         CDS       T02385                                 
Symbol
NFKBIE
Name
(RefSeq) NF-kappa-B inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
fca  Felis catus (domestic cat)
Pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca04920  Adipocytokine signaling pathway
fca05169  Epstein-Barr virus infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101096065 (NFKBIE)
   04658 Th1 and Th2 cell differentiation
    101096065 (NFKBIE)
   04659 Th17 cell differentiation
    101096065 (NFKBIE)
   04662 B cell receptor signaling pathway
    101096065 (NFKBIE)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101096065 (NFKBIE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101096065 (NFKBIE)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101096065 (NFKBIE)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101096065 (NFKBIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101096065 (NFKBIE)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101096065 (NFKBIE)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 101096065
NCBI-ProteinID: XP_003986249
Ensembl: ENSFCAG00000009769
LinkDB
Position
B2:complement(44992298..45001630)
AA seq 476 aa
MASHCLMLNTSSPLWSSTGRKSTSVGGGAGGAGRESASDWAVQLLGVAAAWNPPALRASP
ALLADPSGPRSPGGTPLRAGRQLRKADLQPGKAARRSPEPDPARTWPPWAGTAGMSEARK
GPDETDESQYDSGIESLRSLRSLPEPTPAPASGPSDSGGPQPWTHPPGTAKEPQEKEDTD
GERADSTYGSSSLTEPLPLLGGTETEDPAPRSPLPAAGALSPQQLEALTYISEDGDTLVH
LAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGASRVLQD
RHGDTALHVACQRQHLACARCLLEGRPEPGRGPPHCLDLQLQNWQGLACLHIATLQRNRP
LMELLLQNGADIDTQEGTSGKTALHLAVETQERGLVQFLLQAGARVDARMLNGCTPLHLA
AGRGLSSISSTLCEAGADSLLRNVEDETPQDLAEDPLALLPFDDLKISGKPLLCAD
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgtctcactgcctcatgctcaacacatcctctccactctggtcctccacggggagg
aagagcacgtcggtcgggggcggggcaggaggggcggggcgagagagcgcgtccgactgg
gcagtccagctgctcggagtagccgctgcctggaacccgccagcgctccgagcctcgccc
gcgcttctcgccgacccctcgggcccccgcagcccgggaggaacgccactccgggccggg
cgccagctccgcaaggcggacctgcaacccggaaaggcggcgcggcggagcccggagccg
gatcctgctcggacctggcccccgtgggccggcaccgcgggcatgtcggaggcgcgcaag
gggccggacgagacggatgagagccagtacgactcgggcatcgagtctctgcgttctctg
cgctccctgcccgagcccaccccggccccggcctccggaccttcggacagtggcggcccc
cagccttggacccatcctccgggaacagccaaggagccacaggagaaggaagatacagat
ggggagcgagctgactccacctatggctcctcgtcgctcactgagcccctgcccttgttg
ggaggcacggagaccgaggacccagccccacgctctccgctccccgcagcgggagcgctg
agccctcagcagctggaagcactcacttacatctcggaggatggagacacgctggtccac
ttggcggtgattcacgaggccccagccgtgctgctctgttgcctggctttgctgccccag
gaagtcctggacattcagaacaacctttaccagacagcactccatctggctgtacatctg
gaccagccgggtgcagttcgggccctggtgctgaagggggccagtcgggtgctacaggat
agacacggtgacacggccctgcatgtggcctgccagcgccagcacttggcctgtgcccgc
tgcctgctggaggggcggccagagccgggccgaggaccacctcactgcctggacctccag
ctgcaaaactggcaaggtctggcctgcctccacatcgccaccctgcagaggaaccggcca
ctcatggaactgctgctgcagaacggagctgacattgacacacaggagggcaccagtggg
aaaacagccctgcacctggctgtggagacccaggagcggggtctggtgcagttcctgctc
caggctggcgcacgcgtagacgcccgcatgctcaacgggtgcacacccctgcaccttgcg
gcaggtcggggcctcagcagcatctcatccactctgtgcgaggcaggtgccgactccctg
ctgcggaacgtggaagacgagactccccaggacctggctgaggaccccttggctcttttg
ccctttgatgacctgaagatctctgggaagccactgctgtgtgccgactga

KEGG   Felis catus (domestic cat): 101099259
Entry
101099259         CDS       T02385                                 
Symbol
NFKBIB
Name
(RefSeq) NF-kappa-B inhibitor beta isoform X1
  KO
K02581  NF-kappa-B inhibitor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca04920  Adipocytokine signaling pathway
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05162  Measles
fca05164  Influenza A
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101099259 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    101099259 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    101099259 (NFKBIB)
   04660 T cell receptor signaling pathway
    101099259 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    101099259 (NFKBIB)
   04659 Th17 cell differentiation
    101099259 (NFKBIB)
   04662 B cell receptor signaling pathway
    101099259 (NFKBIB)
   04062 Chemokine signaling pathway
    101099259 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101099259 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101099259 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101099259 (NFKBIB)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101099259 (NFKBIB)
   05164 Influenza A
    101099259 (NFKBIB)
   05162 Measles
    101099259 (NFKBIB)
   05169 Epstein-Barr virus infection
    101099259 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101099259 (NFKBIB)
   05140 Leishmaniasis
    101099259 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101099259 (NFKBIB)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101099259 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 101099259
NCBI-ProteinID: XP_004001685
Ensembl: ENSFCAG00000003186
LinkDB
Position
E2:complement(15172666..15181733)
AA seq 354 aa
MAGVACLGKVAEADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
RVAERGGHTALHLACRMRAHACARVLLQPRPRCARGAPNTYLAQGPDRTSDADRLPVASY
PDPDSEKEDDESEEDWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLREAGADLNKPEPTC
GRSPLHLAVEAQAADVLELLLRAGADPAARMYGGRTPLGSATLRPNPILARLLRAHGAAE
PEDEDDRPGPCSSSSDSDSGDEGDEYDDIVVHSGRGQNRLPPTPASKPLPDDPV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggcgggggtcgcgtgcttggggaaagttgcggaggccgacgaatggtgcgacagtgga
ctgggctctctgggtccggacgcagcagcccccggaggaccggggctgggcgccgagctg
ggcccgggtctgtcgtgggcgcccctcgtcttcggctacgtcactgaggatggggacacg
gcattgcacttggcagtgattcatcagcatgagcccttcctggatttcctcctaggcttc
gcggctggcaccgagtacctggacttgcagaatgacctgggccagacagcccttcacctg
gcagccatcctgggggaggcctccacagtggagaagttgtacgcggcgggtgccgggttg
cgtgtggcggagcgcgggggccacacggcactgcacctggcctgtcgcatgagggcacac
gcctgcgcccgtgtgctactccagccccgtccccggtgcgccaggggagcccccaacacc
tacctcgctcagggccccgaccgcacctctgacgccgaccgcctacctgtcgcctcgtac
cccgaccccgactcggagaaggaagatgacgagagcgaggaggattggaagctgcagctg
gaggctgaaaactatgagggccataccccgcttcacgtggccgtcatccacaaagacgca
gagatggtccggctgctccgggaggctggagctgacctcaacaaaccggagcccacgtgc
ggccggagccccctgcacttggcagtggaggcccaagcagccgacgtgctggagcttctc
ctgagggcaggggccgaccctgccgcccgcatgtacggtggccgcaccccactgggtagt
gccacgctccggcccaaccccatcctcgcccgccttctccgtgcacatggagccgctgag
cccgaggacgaggacgacagacccggcccctgcagcagcagtagcgacagtgacagcggg
gacgagggcgacgaatacgacgacatcgtggtccacagtggccgcggccaaaaccggcta
cctcccaccccagcctcgaaacctctccctgatgaccccgtctga

DBGET integrated database retrieval system