Felis catus (domestic cat): 101090655 Help Entry 101090655         CDS       T02385                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism fca  Felis catus (domestic cat) Pathway fca04621   NOD-like receptor signaling pathway fca05012   Parkinson disease fca05132   Salmonella infection fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101090655 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101090655 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     101090655 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101090655 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:fca03110]     101090655 (TXN) Chaperones and folding catalysts [BR:fca03110]  Protein folding catalysts   Protein disulfide isomerase    101090655 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  101090655 NCBI-ProteinID:  XP_023098326 Ensembl:  ENSFCAG00000046764 UniProt:  A0A337RU81 LinkDB All DBs Position D4:complement(70772089..70785818) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggcgctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system