KEGG   Felis catus (domestic cat): 101090683
Entry
101090683         CDS       T02385                                 
Symbol
ADA
Name
(RefSeq) adenosine deaminase isoform X2
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01232  Nucleotide metabolism
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101090683 (ADA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101090683 (ADA)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     101090683 (ADA)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 101090683
NCBI-ProteinID: XP_006929795
Ensembl: ENSFCAG00000002474
LinkDB
Position
A3:16280385..16308219
AA seq 312 aa
MDKPTSLPGFLAKFDYYMPVIAGSREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSK
VEPIPWDQAEGDLTPDEVVAVVNQGLQEGERDFGVKVRSILCCMRHQPNWSLEVVELCKK
YQHQTVVAIDLAGDETIQGSSLFPGHVQAYEEAVRSGIHRTVHAGEVGSAEVVRQAVDTL
KTERVGHGYHTLDDEALYTRLRRENLHFEVCPWSSYLTGAWKSDTEHPVVRFKRDQANYS
LNTDDPLIFKSTLETDYQMTKQNMGFTEEEFKRLNINAAKSSFLPEDEKRKLLDLLYKAY
GMPSLAAAGQRL
NT seq 939 nt   +upstreamnt  +downstreamnt
atggacaagcccaccagcctcccaggtttcctggccaagtttgactactacatgcctgtc
atcgcgggctcccgggaggccatcaaaaggatcgcctatgagtttgtcgagatgaaggcc
aaggagggcgtggtgtatgtggaggtgcgttacagcccgcacctgctggccaactctaaa
gtggagccgatcccctgggaccaggccgaaggggatctcacccccgacgaggtggtggct
gtggtgaaccagggcctgcaggagggagagcgagactttggggtgaaggtgcggtctatc
ctgtgctgcatgcgccaccagcccaactggtccctggaggtggtggagctgtgtaagaag
taccagcatcagactgtggtggccattgacctggctggagacgagaccatccaagggagc
agcctcttcccgggacacgtgcaggcctacgaggaggccgtgaggagcggcattcaccgc
actgtccatgcaggggaggtgggctccgcggaggtggtgagacaggccgtggacacgctt
aagacggagagggtgggacacggctaccacacgctggatgacgaggccctttacacccgg
ctgcgccgcgaaaacctgcattttgaggtctgcccctggtccagctacctcacaggcgcc
tggaagtcagacacggagcacccggtggttcggttcaaacgtgaccaggctaactactca
ctcaacacggatgaccctctcatcttcaagtccaccctggaaaccgattaccaaatgacc
aaacagaacatgggctttactgaagaggagttcaagaggctgaacatcaatgcagcaaag
tccagtttcctcccggaagatgagaagaggaagcttcttgatctgctctataaagcctat
gggatgccatctttggctgctgcagggcagcgtctctga

DBGET integrated database retrieval system