KEGG   Felis catus (domestic cat): 101090780
Entry
101090780         CDS       T02385                                 
Symbol
LRP1
Name
(RefSeq) prolow-density lipoprotein receptor-related protein 1 isoform X2
  KO
K04550  low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
fca  Felis catus (domestic cat)
Pathway
fca04979  Cholesterol metabolism
fca05010  Alzheimer disease
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    101090780 (LRP1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101090780 (LRP1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090780 (LRP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090780 (LRP1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101090780 (LRP1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101090780 (LRP1)
CD molecules [BR:fca04090]
 Proteins
  101090780 (LRP1)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 SGL cEGF EGF_CA EGF
Other DBs
NCBI-GeneID: 101090780
NCBI-ProteinID: XP_003988980
Ensembl: ENSFCAG00000000185
UniProt: M3VU91
LinkDB
Position
B4:85616225..85699231
AA seq 4544 aa
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTEMCILMSRLCNGVQDCVDGSDEGPHCRELQGQCSQLGC
QHHCVPTLNGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYTNE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQFGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGTGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDTDGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHNDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDSN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTISRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCNKADGSESVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQL
CLPTSESTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGGGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQRINDDGSGRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDI
PQQPMGIIAVANDTNSCELSPCRVNNGGCQDLCLLTHQGHVNCSCRGGRILQEDLTCRAV
NSSCRAQDEFECANGECINFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVS
NMLWCNGADDCGDGSDEIPCNKTACRVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS
ATDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDD
REFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECDG
ENDCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGCH
VNECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSSTFPCSQRCINTH
GSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCD
KGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGR
SVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLF
EDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQ
CNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTD
NCGDGTDEEDCEPPTAQTPHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDP
KLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNN
TKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESV
RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMP
RGIAVDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDW
GNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPI
VAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTC
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEYCRNGGTCAASPSGMPTCRCPT
GFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSSYCENFGTCQM
AADGSRQCRCTAYFEGPRCEVNKCSRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCVGH
CSNGGSCTMNSKMMPECQCPPHMAGPRCEEQVVSQQQPGHMASILIPLLLLLLVLLVAGV
VFWYKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
NT seq 13635 nt   +upstreamnt  +downstreamnt
atgctgaccccgccgctgctgctgttgctgcccctgctctcagctctcgtcgcggctgct
atcgacgcccctaagacttgtagccccaaacagtttgcctgcagagaccagatcacctgt
atctccaaaggctggcggtgtgatggtgagagggactgcccggacggatccgatgaggcc
cctgagatttgtccacagagtaaggcccagcggtgtcagccaaatgaacacaattgcctg
ggcaccgagatgtgtattctcatgtcccgcctctgcaatggagtccaggactgcgtggat
ggttcggatgaggggccccactgccgagagctccaaggacagtgttctcagctgggctgc
cagcaccactgtgtccccacactcaacgggcccacctgctactgcaacaatagctttcaa
ctacaggcagatggcaagacctgcaaagactttgatgagtgctcagtttacggcacctgc
agccagctgtgcaccaacacagatggctcctttacatgtggctgtgtggaaggatacctg
ctgcagccagacaaccgctcctgcaaggccaagaatgagccagtagaccggccccctgtg
ctgctgattgccaactcccagaacatcctggctacgtacctgagtggggcccaagtgtct
accatcacgcccactagtacacggcagaccacagccatggacttcagctacaccaacgag
actgtgtgttgggtgcatgttggggacagcgctgcccagacacagctcaagtgtgcccgc
atgcccggcctgaagggcttcgtggatgagcacaccatcaacatctccctcagtctgcac
catgtggaacagatggccatcgactggctgacgggcaacttctactttgtggatgacatc
gacgataggatctttgtctgcaaccgaaacggggacacgtgtgtcactttgctggacctg
gagctctacaaccccaagggcattgccctggaccctgccatggggaaggtgttcttcact
gactatgggcagatcccaaaggtggagcgctgcgacatggatgggcagaaccgcaccaag
ctggtcgatagcaagattgtgtttcctcacggcatcacgctggacctggtcagccgcctt
gtctactgggctgacgcctacctggactatatagaggtggtagactacgagggcaagggc
cggcagaccatcatccagggcattctgattgagcatctgtatggcctgaccgtgtttgag
aattatctctatgccaccaactcggacaacgccaatgcccagcagaagacgagcgtgatc
cgagtgaatcgattcaacagcactgactaccaggtcgtcacccgtgtggacaagggtggt
gccctccatatctaccaccagcggcgtcagccccgagtgaggagccacgcctgtgagaat
gaccagttcgggaagccaggtggctgctccgacatctgcctgctggccaacagccacaag
gcgcggacctgccgctgccgttccggcttcagcctgggcagtgacgggaagtcatgcaag
aagccagaacatgagctgttccttgtgtatggcaagggccggccaggcatcatccggggc
atggatatgggagccaaagtcccagacgaacacatgatccccattgagaacctcatgaac
ccccgggccttggacttccatgctgaaactggcttcatctactttgctgacaccaccagc
tacctcattggccgccagaagatcgatggcactgagcgggagaccatcctgaaggacggt
atccacaatgtggagggtgtggctgtggactggatgggggacaatttgtattggacggat
gatggacccaagaagaccatcagcgtggccaggctggagaaggctgctcagacccgcaag
accttaatcgagggcaaaatgacgcaccccagggccattgtggtggacccactcaatggg
tggatgtactggacagactgggaggaggaccccaaggacagtcgacgagggcggctggag
agggcctggatggatggctcacaccgagacatctttgtcacctctaagacagtgctttgg
cccaatgggctgagcctggacatcccagctgggcgcctctactgggtggatgccttctat
gaccgcattgagaccatactgctcaatggcacagaccggaagattgtatatgagggtcct
gagctgaaccacgcctttggcctgtgtcaccacggcaactacctcttctggactgagtac
cggagtggcagtgtttaccgcttagaacggggcacaggcggtgcaccccctaccgtgacc
cttctgcgcagtgagcggccccccatctttgagatccgcatgtatgatgctcagcagcag
caagtgggtaccaacaaatgccgggtgaacaacggtggctgcagcagcctgtgcctggcc
acccctgggagccgccagtgtgcctgcgccgaggaccaggtgttggacacagacggtgtc
acctgtttggcgaacccatcctacgtgcccccaccccagtgccagccaggcgagtttgcc
tgcgccaacagccgctgcatccaggagcgctggaagtgtgacggggacaacgactgcctg
gacaacagtgacgaggccccagccctctgccatcagcacacctgcccctcggacaggttc
aagtgcgagaacaaccgatgcatccccaaccgctggctctgtgacggggacaacgactgt
gggaacagtgaagacgagtccaatgccacttgttcagctcgcacctgcccacccaaccag
ttctcctgtgccagtggccgctgcatccccatctcctggacgtgtgatctggatgatgac
tgtggggaccgttctgacgagtccgcttcatgtgcctatcccacctgcttccccctgact
cagtttacctgcaacaatggcagatgcatcaacatcaactggagatgtgataatgacaat
gactgtggggataacagtgatgaggccggctgcagccactcctgctccagcactcagttc
aagtgcaacagcgggcgctgcatccccgagcactggacctgtgacggtgacaacgactgc
ggggactacagcgacgagacacacgccaactgcaccaaccaggccacacggcctcccggt
ggctgccacaatgatgagttccagtgccgactggatggtctgtgcattccgttgcgctgg
cgctgtgatggagacactgactgcatggactccagtgatgagaagagctgtgagggagtg
acccacgtctgtgaccccaatgtcaagtttggctgcaaggactccgctcgatgcatcagc
aaagcttgggtgtgtgatggcgacagtgactgtgaagataactcggatgaggagaactgt
gagtccctggcctgcaggccgccctcacacccctgcgccaacaacacctcagtctgcctg
ccccccgacaaactgtgtgatggcaacgacgactgtggagacggctcagacgagggagag
ctctgcgaccagtgctctctgaataacggaggctgcagccacaactgctcggtggcacct
ggcgaaggcattgtgtgttcgtgccctctgggcatggagctggggcccgacaaccacacc
tgccagatccagagctactgtgccaagcacctcaagtgcagccagaagtgtgaccagaac
aagttcagcgtgaagtgctcctgctacgagggctgggtgctggagccggacggcgagagc
tgccgcagcctagatcccttcaagccattcatcatcttctccaaccgccatgagatccgg
cgcatcgaccttcacaaaggggactacagcgttctggtgcccggtctgcgcaacaccatc
gccctggacttccacctcagccagagcgccctctactggactgatgtggtggaggacaag
atctaccgcgggaagctgctggacaacggagccctgactagtttcgaggtggtgattcag
tacggcctggccacccctgagggtctggctgtagactggattgcaggcaacatctactgg
gtggagagtaacttggaccagattgaagtggccaagctggatgggacccttcggaccacc
ctcctggctggtgacattgagcacccaagggcaatcgcgctggatccacgggatgggatc
ctgttttggacagactgggatgccagcctgccccgcatcgaggccgcctccatgagtggg
gccgggcgacgtaccatccaccgggagacaggttcgggcggctggcccaacgggctcacg
gtggactacctggagaagcgcatcctctggatcgatgccaggtcagatgccatttactca
gcccgttacgacggctccggccacatggaggtgcttcggggacacgagttcctatcgcac
ccgtttgcagtgacgctgtatgggggggaggtgtattggacggactggcggacaaacaca
ctggccaaggccaacaagtggaccggccacaatgtcaccgtggtacagaggaccaatacc
cagccctttgatctgcaggtgtaccacccctcccggcagcccatggctcctaatccttgt
gaggctaatgggggccgaggcccctgctcccacctgtgtctcatcaactacaaccggacc
gtctcctgcgcctgcccccacctcatgaagctccacaaggacaacaccacgtgctatgag
tttaagaagttcctgctgtacgcacgtcagatggagatccgaggggtggacctggatgca
ccctactacaactacatcatctctttcacggtgcccgatattgacaacgtcacggtgctg
gactatgatgcccgcgagcagcgcgtctactggtccgatgtgcggacacaggccatcaaa
cgggccttcatcaatggcacaggcgtggagactgtcgtctctgcagacttgccaaatgcc
catgggctggctgtggactgggtgtcccgaaacctgttctggacaagctacgacagcaac
aagaagcagatcaacgtggcccggctggacggctccttcaagaatgcagtggtgcagggc
ctggagcagccccatggcctggttgtccaccccttgcgtgggaagctctattggaccgat
ggggacaacatcagcatggccaacatggatggcagcaaccgtaccctgctcttcagtggc
cagaagggccctgtgggcctggctatcgacttccctgaaagcaaactctactggatcagc
tctgggaaccacaccatcagccgctgcaacctggacgggagtgggctagaggtcatcgat
gccatgcggagccagctgggcaaggccactgccctggccatcatgggggacaagctgtgg
tgggcagatcaggtgtcagagaagatgggcacgtgcaataaggctgatggctcagaatct
gtggtcctgcggaatagcaccaccctggtgatgcacatgaaggtctacgacgagagcatc
cagctggaccatgagggcaccaacccctgcagtgtcaacaacggtgactgctcccagctc
tgcctgcccacatcggagtcgacccgttcctgtatgtgcacagccggctacagcctccgg
agtggccagcaggcctgcgagggtgtgggctcctttctcctgtactctgtgcacgaggga
atccggggaatccccttggatcccaatgataagtcagatgccctggtcccagtgtcgggg
acctccctggctgtcggcattgatttccatgctgaaaatgacaccatttactgggtggac
atgggcctaagtaccattagccgggctaagcgagaccagacatggcgcgaggatgtggtg
accaatggcattggccgtgtggagggcattgcagtggactggatcgcaggcaacatctac
tggacagaccaaggctttgatgtcatcgaggtcgccaggctcaatggctctttccgctac
gtggtcatctcccagggtctggataagccccgagccatcactgtccacccagagaagggg
tatctgttctggactgagtggggccagtatccacgtatcgagcggtctcggctagatggt
actgagcgagttgtgctggttaatgtcagcatcagctggcccaatggcatctcagtggac
tatcaggatgggaagctatactggtgcgatgcccggacagacaagatcgagcggatcgac
ctggagacgggcgagaaccgtgaggtggttctgtccagcaacaatatggacatgttctca
gtgtctgtgtttgaggatttcatctactggagtgacaggactcacgccaatggctccatc
aagcgtgggagtaaagacaatgccacagactcggtgcccctgagaacaggcatcggcgtc
cagctcaaagacatcaaagtcttcaaccgggaccggcagaaaggtaccaacgtgtgtgca
gtggctaatggcgggtgccagcagctgtgcctgtaccggggcggggggcagcgggcgtgt
gcctgcgcccacgggatgctggctgaagacggggcatcgtgccgggagtacgcgggctac
ctgctctactcagagcgcaccatcctcaagagcatccacctgtctgatgagcgcaacctc
aatgcacccgtgcaaccctttgaggatcctgagcacatgaagaatgtcatcgctctggcc
tttgactaccgagcaggcacctccccgggcacccccaatcgcatcttcttcagcgacatc
cactttgggaacatccaacggatcaatgacgatggctcagggaggatcaccattgtggag
aatgtgggctctgtggagggcctggcctatcaccgtggctgggacactctctactggaca
agctacacaacatccaccatcacccgccacacagtagaccagacccgcccaggagccttt
gagcgtgagacggtcattactatgtctggagacgaccacccacgagcctttgtgctggac
gagtgtcagaacctgatgttctggaccaactggaacgagcagcaccccagcatcatgcgg
gcagccctgtcgggggccaatgtcctgactctcatcgagaaggacatccgcacccccaat
ggcctggccatcgaccaccgtgccgagaagctctacttctccgacgccaccctagacaag
atcgagcgctgcgagtatgacggctcccaccgctatgtgatcctgaagtccgagccagtc
caccccttcgggttggctgtgtacggggagcacattttctggaccgactgggtgcggcgg
gctgtgcagcgggccaacaagtacgtgggcagtgacatgaagctgctgcgcgtggacatc
ccccagcagcccatgggcatcatcgccgtggccaatgacaccaacagctgtgagctctcc
ccttgccgcgtcaacaacgggggctgccaagacctatgtctgctcactcaccaaggccat
gtcaactgctcctgccgagggggccgcatcctccaagaggacctcacctgccgggctgtg
aactcctcttgccgagcacaagatgagttcgagtgtgccaacggcgagtgcatcaacttc
agcctgacctgtgacggtgtctcccactgcaaggacaagtctgacgagaagccatcctac
tgtaactcacgccgctgcaagaagactttccgacagtgtaacaacgggcgctgtgtgtcc
aacatgctgtggtgcaacggggcggacgactgtggggacggctcggatgagattccctgc
aacaagacggcctgcagagtgggagaattccgctgccgggatggcacctgcattgggaac
tccagccgctgcaaccagtttgtggactgtgaggacgcctccgatgagatgaactgcagc
gccactgactgtagcagctacttccgcctgggggtgaaaggagtgcgcttccagccctgt
gagcggacctccctctgctatgcacccagctgggtgtgtgacggtgccaatgactgtggg
gactacagcgacgagcgcgactgcccaggagtgaagcgacccagatgccccttgaattac
tttgcctgccccagtgggcgctgcatccccatgagctggacatgtgacaaggaagacgac
tgtgagcacggcgaggatgagacccactgcaacaagttctgctcggaggcccagtttgag
tgccagaaccatcggtgcatctccaagcagtggctatgtgatggcagtgatgactgcgga
gatggctcagatgaggcggctcactgtgaaggcaagacgtgcggcccctcctccttctcc
tgcccgggcacccatgtgtgtgtccccgagcgctggctctgtgatggtgacaaggactgt
gctgacggtgccgacgagagcatcgcggccggctgcttgtacaacagcacctgtgatgac
cgcgagttcatgtgccaaaatcgccagtgcatccctaagcatttcgtgtgtgaccatgac
cgtgactgtgccgatggctccgacgagtcccctgagtgtgagtacccaacgtgcggcccc
aacgagttccgctgtgccaatgggcgctgtctgagctcccgccagtgggagtgcgatggg
gaaaatgactgccacgaccagagcgacgaggcccccaagaacccgcactgcaccagccca
gagcacaagtgcaacgcctcctcgcagttcctgtgcagcagcgggcgctgtgtggccgag
gcgctgctctgcaacggccaagatgactgtggtgacggctcggatgagcgtggctgccac
gtcaacgagtgtctcagccgcaagctcagtggctgcagccaggactgcgaggacctcaag
attggcttcaagtgccgctgccgccccggcttccgcctgaaggatgatggccggacgtgt
gccgatgtggatgagtgcagctcgaccttcccctgcagccagcgctgcatcaacacgcac
ggcagctacaagtgtctgtgtgtagagggctacgccccccgaggcggcgacccccacagc
tgcaaagcggtgactgatgaggagccattcctgatctttgccaaccggtactacctgcgc
aagctcaacctggacggctccaactacacgctgttgaagcagggcctgaacaatgccgtc
gccttggactttgactaccgagagcagatgatttactggacagacgtgacaacccagggc
agcatgatccgaaggatgcaccttaacggaagcaatgtgcaggtgctgcaccggacaggc
ctcagcaaccctgacgggctggctgtggactgggtgggtggcaacctgtactggtgcgac
aaaggtcgggacaccatcgaagtgtcaaagctcaacggggcctaccggacggtgctggtc
agctctggcctccgtgagcccagagctctggtggtggacgtgcagaatgggtacctgtac
tggacagactggggtgaccactcactgatcggccggataggcatggatgggtctggccgt
agtgtcatcgtggacaccaagatcacgtggcccaacggcctgacactggactacgtcacc
gagcgcatctactgggctgatgcccgtgaggactacatcgagtttgccagcctggatggc
tctaatcgccacgtcgtgctgagccaggacatcccacacatcttcgcactgaccctgttt
gaggactacgtgtactggactgactgggagacaaagtccatcaaccgagcccacaagacc
acgggcaccaacaagacactcctcatcagcaccctgcaccggcccatggacttgcatgtc
ttccacgccctgcgccagccagatgtgcccaatcatccatgcaaggtcaacaatggcggc
tgcagcaacctgtgcctcctgtcccccggtgggggccacaaatgtgcctgtcctaccaac
ttctacctgggcagcgatgggcgcacctgtgtgtccaactgcacagcaagtcagtttgtg
tgcaagaacgacaagtgcatccccttctggtggaaatgtgacacagaggacgactgtggg
gaccactcagacgagcccccggactgtcccgaattcaagtgccgcccaggacagttccag
tgctcaacaggcatctgcacgaaccctgccttcatctgtgacggggacaacgactgccag
gacaacagtgacgaggccaactgcgatatccacgtctgcttgcccagtcagttcaagtgc
accaacaccaaccgttgcatccccggaatcttccgttgcaatgggcaggacaactgtgga
gacggggaggacgagagggactgccccgaagtgacctgtgcccccaaccagttccagtgc
tccatcaccaagcgctgcatcccccgagtctgggtctgtgaccgggacaacgactgcgtg
gatggcagcgatgagcctgccaactgcacccagatgacctgtggagtggatgagttccgc
tgcaaggactccggccgctgtatccccgctcgctggaagtgtgatggagaggacgactgt
ggggacggctccgacgagccaaaggaggagtgtgacgagcgcacctgtgagccctaccag
ttccgctgcaagaacaaccgttgcgtgccagggcgctggcagtgcgattatgacaacgac
tgtggggataactcagacgaggagagctgcacccctcggccctgctctgagagcgagttc
tcctgtgccaatggccgctgcattgctgggcgctggaaatgcgatggggaccatgactgt
gcagatggctcagacgagaaagactgcaccccccgctgtgacatggaccagttccagtgc
aagagtggtcactgcatccctctgcgctggcgctgtgatgcggatgccgactgcatggac
ggcagtgatgaggaagcctgtggcactggcgtgcggacctgccccctggacgagttccag
tgcaacaacacgctgtgcaagccgctggcgtggaagtgcgatggcgaggacgactgcggg
gacaattcagacgaaaacccggaggagtgcgccaggtttgtgtgccctcctaaccggccc
ttccgttgcaagaacgaccgcgtctgcctgtggatcgggcgccaatgcgatggcaccgac
aactgcggggatgggactgatgaggaggactgtgagccccccacggcccagaccccccac
tgcaaagacaagaaggagtttctgtgccggaaccagcgctgcctgtcctcctcgctgcgc
tgcaacatgttcgatgactgcggggacggctctgatgaggaggactgcagcatcgacccc
aagctgaccagctgcgccaccaacgccagcatctgcggggatgaggcacgctgcgtgcgc
accgagaaagccgcctactgcgcctgccgctcgggtttccacactgtgccaggccagccc
ggatgccaagacatcaatgagtgcctgcgcttcggcacctgctcacagctctgcaacaac
actaagggtggccacctctgcagctgcgcccgcaacttcatgaagactcacaacacctgc
aaggccgaaggctctgagtatcaggtcctatacatcgccgatgacaacgagatccgcagc
ctgttccccagtcacccccattcggcttatgagcaggccttccagggtgacgagagtgtc
cgcattgatgccatggatgtccatgtcaaggctggccgtgtctattggaccaactggcac
acaggcaccatctcttaccgcagcctgccacctgccgcacctcccaccacttccaaccgc
caccggcgacagattgaccggggtgtcacccacctcaatatctcagggctcaagatgcca
cggggcatcgccgtcgactgggtggccgggaacgtgtactggactgactcaggccgagat
gtgatcgaggtggcgcaaatgaagggcgagaaccgcaagacgctcatctcgggcatgatc
gacgagccgcacgccattgtggtggacccactgagaggcaccatgtactggtcagactgg
gggaatcaccccaaaattgaaacggcagcaatggacgggacccttcgggagacactggta
caggacaacatccaatggcctacaggcctagctgtggattatcacaatgaaaggctgtac
tgggcagatgccaagctctcggtcatcggcagcatccggctcaatggcacggaccccatc
gtggctgctgacagcaaacgaggcctaagtcaccccttcagcatcgacgtctttgaggat
tacatctacggcgtcacctacattaataatcgtgtcttcaagattcataagtttggacac
agccccttgatcaacctgacagggggcctgagccacgcctccgatgtggtcctgtaccac
caacacaaacagcctgaagtgaccaacccctgtgaccgcaagaagtgtgagtggctctgc
ctgctgagccccagcgggcccgtctgcacctgtcccaacgggaagcggctggacaatggc
acctgtgtggccgtgccctcgcccacgccaccaccagatgctcctcgacccggaacctgt
aacctgcagtgcttcaatggcggcagctgcttcctcaatgcacggaggcagcccaagtgc
cgctgccagccccgatacacaggcgacaagtgtgagctggaccagtgctgggagtactgt
cgcaacgggggcacctgcgctgcctccccctctggcatgcccacgtgccgctgccccaca
ggcttcacgggccccaaatgcacccagcaggtgtgtgcgggctactgtgccaacaacagc
acctgcaccgtcaaccagggcaaccagccccagtgccgatgcctacctggcttcctgggt
gaccgctgccagtaccggcagtgctccagctactgtgagaactttggcacgtgccagatg
gccgccgacggctcccggcagtgccgctgcaccgcctacttcgaggggccgaggtgcgag
gtaaacaagtgcagccgctgtctggatggagcctgtgtggtcaacaagcagagtggggac
gtcacctgcaactgctctgatggccgggtggcccccagctgtctgacctgtgttggccac
tgcagcaatggtggttcctgtaccatgaacagcaaaatgatgcctgagtgccagtgccca
ccccacatggcggggccccggtgtgaggagcaggtggtcagccagcagcagcctggacat
atggcctctatcctcatccctctgctgttgttgctgctggtgcttctggtagccggagtg
gttttctggtacaagcggcgagtccgaggggctaagggcttccagcaccagcggatgacc
aatggggccatgaatgtggagattgggaaccccacgtataagatgtatgaaggcggggag
cctgacgacgtagggggcctactggatgctgactttgcactggaccctgacaagcccacc
aacttcaccaaccctgtgtatgccacactctacatgggtggccacggcagccgccactcc
ctggccagcacggacgagaagcgagaactcctgggccggggtcctgaggacgagataggg
gaccccttggcatag

DBGET integrated database retrieval system