KEGG   Felis catus (domestic cat): 101091039
Entry
101091039         CDS       T02385                                 
Symbol
AIRE
Name
(RefSeq) autoimmune regulator
  KO
K10603  autoimmune regulator
Organism
fca  Felis catus (domestic cat)
Pathway
fca04120  Ubiquitin mediated proteolysis
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101091039 (AIRE)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101091039 (AIRE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101091039 (AIRE)
   04121 Ubiquitin system [BR:fca04121]
    101091039 (AIRE)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   SAND domain-containing proteins
    101091039 (AIRE)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101091039 (AIRE)
SSDB
Motif
Pfam: HSR PHD SAND zf-HC5HC2H zf-HC5HC2H_2 C1_1
Other DBs
NCBI-GeneID: 101091039
NCBI-ProteinID: XP_023116632
LinkDB
Position
C2:complement(2219435..2230004)
AA seq 587 aa
MAQTPHKSSGTPRPRDPRRGEGAPSPAPPDPTTAGEAQAGGDTVLRHLLRLYRTEIAMAV
DGAFPLLHALADHDVVPEDKFQETLRLKEKEGCPQAFHALLSWLLTQDAAAILDFWRVLF
KDYNLERYARLQPILDCFPKDVDLSQPRKGRKPPTGPKAPVLLPRPPSKRKALEEPRAAP
PGALSPRGTSNPGSQAKAKHPRKPDSNAEPQRPLLGNGIQTMSSTSVQRAVTVSSGDVPG
AHGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPGAGKNKARSGGPKTLVRAKGIQ
ASAPGGGDPRAGAQGRVQAPPALPSEPQPHQKNEDECAVCRDGGELICCDGCPRAFHLAC
LSPPLREIPSGTWRCYSCLRGGGQRDPPQAEDPQPQEPPAETQVLLGLKLTGEEAKGLSR
EPSAGMDAAGPYKHLLAPPSAAPLTVLNPSALRPLLCVGPEGQQGPAGARCGVCGDGADA
LRCAHCAAAFHWRCHFPAGAARPGAVPRCRSCSGDTAPAPEEGAPAPTPARAAPGPAKAG
DGSAGHEPGVHRDDLESLLSEHSFDGILQWAIQSMARPLAEAPTFPS
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggcccagacaccccacaagtccagtggtaccccaaggccgcgggaccccaggcggggg
gagggggcccccagccccgcgcccccagaccccacgacggcgggtgaggcccaggcaggt
ggggacacggtgcttcgtcacctcctgaggctgtaccgcactgagatcgccatggctgtg
gacggcgccttcccgctgctgcacgcgctggctgaccacgacgtggtccccgaggacaag
ttccaggagaccctgcggctgaaggagaaggagggctgcccgcaggccttccacgcgctc
ctttcgtggctcctgacccaagacgcagctgccatcctggacttctggagggttctcttt
aaggactacaatctggagagatacgcccggctgcagcccatcctagactgtttccccaaa
gacgtggacctcagccagccgaggaaggggagaaagcccccgacgggccccaaggcccca
gtgctgctgcccagacccccctccaagaggaaggccctggaggagcccagggccgcccca
cccggggcactgtctcctaggggcacctccaacccaggctcccaggcaaaggccaagcac
cccaggaagccggacagcaacgcagagccgcagcgccccctgctggggaatggaattcag
accatgtcgtccacttcggtccagagagccgtgaccgtgtcgtctggggacgtccccgga
gcccatggggcagtggagggcatcctcatccagcaggtgtttgagtcaggtggctccaag
aagtgcatccaggttgggggggagttttatactcccagcaagttcgaagaccccggtgcg
gggaagaacaaggcccgtagcggtggcccaaagaccctggtccgagccaaggggatccag
gcttccgcccctggtggaggcgacccgagagcaggcgcacagggcagggtgcaggcccct
cccgccctccccagcgagccccagccccaccagaagaacgaggatgagtgtgccgtgtgc
cgggacggcggggagctcatctgctgtgacggctgcccccgggccttccacctggcctgc
ctgtccccgccgctccgggagattcccagtgggacctggaggtgctacagttgtctccgg
ggaggaggccagcgggaccctccccaggccgaggatccccagccccaggagccgcccgcg
gagacccaggtcctcctggggctgaagctgacgggggaagaggccaaggggttgtccagg
gagccctcagccgggatggacgctgccggcccctacaagcacctgctggccccgccttcc
gcagcccccttgacggtgctgaacccctcagccctgcgccccctactgtgtgtgggcccc
gaggggcagcagggcccggcaggtgcgcggtgcggcgtgtgcggggatggcgcggacgcg
ctgcggtgcgcgcactgcgccgccgccttccactggcgctgccacttccccgcgggcgca
gcgcggcccggggccgtcccgcgctgccgatcctgctccggagacactgccccggccccc
gaggagggcgcgcccgccccgacgccagcccgagccgcgccggggcccgccaaggcaggg
gacggttctgctggtcacgagccgggtgtgcacagggacgacctggaatccctcctaagc
gagcactccttcgacggcatcctgcagtgggccatccagagcatggcccgcccgctggcc
gaggcgcccaccttcccctcctga

DBGET integrated database retrieval system