KEGG   Felis catus (domestic cat): 101091223
Entry
101091223         CDS       T02385                                 
Symbol
HES1
Name
(RefSeq) transcription factor HES-1
  KO
K06054  hairy and enhancer of split 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03460  Fanconi anemia pathway
fca04330  Notch signaling pathway
fca04950  Maturity onset diabetes of the young
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101091223 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101091223 (HES1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091223 (HES1)
  09162 Cancer: specific types
   05224 Breast cancer
    101091223 (HES1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101091223 (HES1)
   05165 Human papillomavirus infection
    101091223 (HES1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    101091223 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101091223 (HES1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101091223 (HES1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    101091223 (HES1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     101091223 (HES1)
SSDB
Motif
Pfam: Hairy_orange HLH MAJIN
Other DBs
NCBI-GeneID: 101091223
NCBI-ProteinID: XP_011284179
Ensembl: ENSFCAG00000029144
UniProt: A0A337SWV8
LinkDB
Position
C2:complement(74647713..74650292)
AA seq 280 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSPAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSSSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt   +upstreamnt  +downstreamnt
atgccagcagatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatccaagcct
atcatggagaaaagacgacgagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctcttaagaaagatagctcgcgacattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggccgcgcta
agcacagacccgagcgtgctggggaagtaccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaacactgaggtgcgcacccggttgctc
ggccacctggccaactgcatgacccagatcaacgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccgccgcccccgccgggacccggcggcccgcagcacgcgccg
ttcgcgccgccaccgccgctcgtgcccatccccgggggcgcggcgccccctcccggcggc
gcgccctgcaagctgggcagcccggccggagaggcggctaaggtgttcggcggcttccag
gtggtgccggctccggacggccagtttgccttcctcatccccaacggggccttcgctcac
agcggccccgtcatcccagtctacaccagcagcagtgggacctccgtgggcccgaacgca
gtgtcgccttccagcggcccctcgctcacggcagactccatgtggaggccgtggcggaac
tga

DBGET integrated database retrieval system