KEGG   Felis catus (domestic cat): 101091492
Entry
101091492         CDS       T02385                                 
Symbol
ATP2A1
Name
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform X2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04919  Thyroid hormone signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101091492 (ATP2A1)
   04024 cAMP signaling pathway
    101091492 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    101091492 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101091492 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101091492 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    101091492 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    101091492 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091492 (ATP2A1)
   05017 Spinocerebellar ataxia
    101091492 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    101091492 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101091492 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101091492 (ATP2A1)
   05414 Dilated cardiomyopathy
    101091492 (ATP2A1)
   05415 Diabetic cardiomyopathy
    101091492 (ATP2A1)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101091492 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 101091492
NCBI-ProteinID: XP_003998782
Ensembl: ENSFCAG00000007746
UniProt: A0A2I2V2N1
LinkDB
Position
E3:22025849..22041424
AA seq 993 aa
MEAAHSKTTEECLAYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKTVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWLRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGNICVLNEFSITGSTYAPEGEVLKNDKPVRSGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFSTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPITGPV
KDKILSVIKEWGTGRDTLRCLALATRDTPPKREEMILDDSARFMEYETDLTFVGVVGMLD
PPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDL
PLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFLYADDGPHVTYSQLTHFMKCNEENPDFEGLDCEVFEAPQPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRA
LDCTQWLMVLKISFPVILLDELLKFIARNYLEG
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggaggctgcacactccaagaccacagaagaatgtctggcctattttggggtgagcgag
actacaggcctgacgccggaccaagtgaagcggcacctagagaaatacggccccaatgag
ctccctgctgaggaagggaagtccctgtgggagttggtgatagagcagtttgaagacctc
ctggtgcggatccttctcctggccgcctgcatttccttcgtgctggcctggttcgaggaa
ggtgaagaaaccatcactgcctttgttgaaccctttgtcatcctcttgatcctcattgcc
aatgccatcgtgggggtttggcaggagcgtaatgcagagaatgccattgaggctctgaag
gaatatgaacccgagatggggaaagtctaccgggctgaccgcaagacagtccagaggatc
aaggctcgggacattgtccccggggacattgtggaggtggctgtgggcgacaaagtgcct
gcagatatccggatcctgtccatcaaatccaccaccctccgggttgaccagtccatcctg
acgggcgagtccgtatctgtcatcaagcacacagaccctgttcctgacccccgagctgtc
aaccaggataagaagaacatgcttttctcgggtaccaacatcgcagctggcaaggcctta
ggcatcgtggccactactggtgtgagcactgagattgggaagatccgtgaccagatggcc
gccacggaacaggacaaaacccctctgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctccctcatctgtgtggccgtctggctcatcaacatcggccatttcaac
gatcccgtccacggcggctcctggttgcggggtgccatctactactttaagattgccgtg
gccctggctgtggccgcgatcccagaaggccttcctgcggtcatcaccacctgcctggcc
ttgggcacccggcggatggcaaagaaaaatgcaatcgtgaggagcctgccctccgtggag
actctgggctgcacctccgtcatctgttccgacaagacgggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttattatcgacaaggtggacggaaacatctgtgtcctgaac
gagttctccatcactggttccacttacgctccagaaggagaggtcttgaagaatgataag
ccagtccgctcagggcagtatgatgggctggtggagttggccaccatttgtgccctctgc
aatgactcctccttggacttcaacgaggccaaaggtgtttacgagaaggtgggtgaggca
acagagacggcgctcaccaccctggtggagaagatgaatgtgttcagcacagacgtgagg
agcctctcgaaagtggagcgggccaacgcctgcaactcagtgatccgccagctgatgaag
aaggaatttaccctggagttctcccgagaccggaagtccatgtctgtctattgctccccg
gccaaatcccgggctgccgtgggcaacaagatgtttgtcaagggtgcccctgagggggtc
atcgaccgctgtaactacgtgcgagttggcaccacccgcgtgccgattacagggccggtg
aaggacaagatcctgtccgtgatcaaggagtggggcaccggccgggataccctgcgctgc
ctggccctggccacccgggacacccccccgaagcgagaggagatgatcctggatgactct
gccaggttcatggagtacgagacggacctgacatttgtcggcgtggtgggcatgctggac
ccaccccgcaaggaggtcacgggctctattcagctgtgccgggatgccggaatccgagtc
atcatgatcaccggggacaacaagggcacagccattgccatctgccgacgaatcggcatc
tttggggagaacgaggaggtggccgaccgagcctacaccggccgggagtttgacgacctg
cccctggcggaacagcgggaggcctgccgtcgcgcctgctgcttcgcccgtgtggagccc
tcccataagtcgaagatcgtggagtatctgcagtcctacgatgagatcacggccatgacg
ggtgatggtgtcaacgatgcccctgccctgaagaaggccgagatcggcatcgccatggga
tccggcaccgccgtggccaagaccgcttccgagatggtgctggccgacgacaacttctcc
accatcgtggctgcggtggaggagggccgcgccatttacaacaacatgaagcagttcatc
cgctacctcatctcctccaacgtgggcgaggtggtctgcatcttcctgaccgccgcctta
ggactgcctgaggccctgatccctgtgcagctgctgtgggtgaacttggtgactgacggg
ctcccggccacagccctgggcttcaacccaccagacctggacatcatggaccggcctccc
cggagccccaaggagcccctcatcagtggctggctcttcttccgctacatggcaatcggg
ggctacgtgggtgcggccactgtgggagcggctgcctggtggttcctgtatgcagatgac
gggcctcatgtcacttacagccagctgactcacttcatgaagtgcaacgaggaaaacccc
gactttgagggcctggactgcgaggtctttgaggccccccagcccatgaccatggccttg
tccgtgctggttaccattgaaatgtgcaacgctctcaacagcctgtctgagaaccagtcc
cttctgcggatgccgccctgggtgaacatctggctgctgggctccatctgcctgtccatg
tccctgcacttcctcatcctctatgtcgatcctctgccgatgatcttcaagctccgggcc
ctggactgcacccagtggctcatggtcctcaagatctcatttccagtcatcctgctcgat
gagctcctcaagttcattgctcggaactacctagagggataa

KEGG   Felis catus (domestic cat): 101101678
Entry
101101678         CDS       T02385                                 
Symbol
ATP2A3
Name
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform X1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04919  Thyroid hormone signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101101678 (ATP2A3)
   04024 cAMP signaling pathway
    101101678 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    101101678 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101101678 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101101678 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    101101678 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    101101678 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101678 (ATP2A3)
   05017 Spinocerebellar ataxia
    101101678 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    101101678 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101101678 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101101678 (ATP2A3)
   05414 Dilated cardiomyopathy
    101101678 (ATP2A3)
   05415 Diabetic cardiomyopathy
    101101678 (ATP2A3)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101101678 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 101101678
NCBI-ProteinID: XP_011287355
Ensembl: ENSFCAG00000007932
UniProt: A0A337SUB3
LinkDB
Position
E1:13217904..13251993
AA seq 999 aa
MEAAHLLSAADVLRRFSVTVEGGLRPEQVTSARERYGPNELPTEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRVRARDIVPGDIVEVAVGDKVPADLRLLEIKSTTLRVDQSIL
TGESVSVTKHTDAILDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLHTELGKIRSQMA
AVEPERTPLQHKLDEFGRQLSRAISVICVAVWVINISHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEAEASSCRLHEFTISGTTYAPEGEVRQAEQLVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTNLQALSRVERASACNAVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPGLAAQGSKMFVKGAPESVIERCSSVRVGSRTVPLNAT
SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMQLDDCGKFAQYEMDLTFVGCVGML
DPPRPEVAACIARCHQAGIRVVMITGDNKGTAVAICRRLGIFKDSEDVVGKAYTGREFDD
LSPEQQRQACRTACCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPHVTFYQLRNFLKCSEDNPLFADIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLAAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRNHVDEEKDKK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggaggcggcgcacctactctcggcagccgacgtgctgcgccgcttctcggtgacggtc
gagggcggcctgaggccagagcaggtgactagcgcgcgagagcgctacggccccaacgag
ctcccaactgaagaagggaagtccctgtgggagctggtgctggagcagtttgaagacctc
ctggtgcgcatcctgctgttggctgccctggtctccttcgtcctggcctggtttgaggag
ggtgaggagaccacaacagccttcgtggaacctctggtcatcatgctgatcctcgtggcc
aatgccatcgtgggcgtatggcaggaacgcaatgctgagagtgccattgaggccctgaaa
gagtatgagcctgagatgggtaaggtgatccgctcggaccgcaagggcgtgcagagggtc
cgcgcccgggacatcgtccctggagacatcgtggaagtagcagtgggagacaaagtgccc
gctgacctccgcctcctcgagatcaagtccaccactctgagagtggaccagtccatcctg
acaggtgaatccgtgtctgtgaccaaacacacagatgctatcctggatcccagagctgtg
aaccaggacaagaagaacatgctattctctggtaccaacattgcatcaggcaaggcactg
ggggtggcagtggccacaggcctgcacacagagctgggtaagatccggagtcagatggcg
gcagtggagccagagcggacaccgctgcagcacaagctggatgagttcgggcggcagctg
tcccgtgccatctctgtgatctgtgtggccgtgtgggtcatcaacatcagccacttcgct
gacccagcccatggtggctcctggcttcgtggtgccgtctactacttcaagattgccgtg
gctctggctgtggctgccatccctgagggcctcccagctgttatcactacatgcctggct
ctgggcacacggcgcatggcacgcaagaatgccattgtgcggagtctgccctctgtggag
acgctgggctgcacctcggtcatctgctccgacaagacaggcacactcaccaccaatcag
atgtctgtctgccggatgttcgtggtagccgaagctgaagcaagctcctgccgtttgcac
gagttcaccatctccggcaccacttacgccccggagggcgaagtgaggcaggcggagcag
ctcgtgcgctgtgggcagttcgatgggctggtggagctggcgacaatctgtgccctgtgc
aacgactcagcgctggactacaatgaggctaagggcgtatatgagaaggtgggagaggcc
acggagacagccctgacttgcctggtggagaaaatgaatgtgtttgacaccaacctccag
gccctgtcccgagtggaacgagccagtgcctgcaatgcggtcatcaagcagctgatgcgg
aaggagtttactttggagttctcccgggaccggaagtccatgtcagtgtactgcacgccc
actcgccctggcctggcagcccagggcagcaagatgtttgtgaagggggctcctgagagt
gtgatcgagcgctgcagctcagtccgagtgggaagccgcacagtacccctgaacgccacc
tccagggagcagatcctcgccaagatccgggattggggctccggctcagacacactgcgt
tgcctggcactggccactcgggatgcacccccaaggaaggaggacatgcagctggatgac
tgcggcaaatttgcgcagtacgagatggacctgacttttgtgggctgcgtgggcatgctg
gaccctccaaggcccgaggtggctgcttgcatcgcacgctgccaccaggccggcatccgt
gtggtcatgatcacaggggacaacaaaggcacagctgtggccatctgccgccggcttggc
atcttcaaggactcagaggatgtggtgggcaaggcctacacgggtcgcgaattcgatgac
ctcagccctgagcagcaacgccaggcctgccgcacagcgtgctgcttcgcccgtgtggaa
cctgcacacaagtcccgaattgtagagaacctacagtccttcaatgagatcaccgccatg
actggagacggggtgaatgatgccccggctctgaagaaagcagagattggcattgccatg
ggctccggcacagctgtggccaagtcggcagctgagatggtgctgtcagatgacaacttt
gcctcaattgtggctgcagtggaggagggccgggccatctacaacaacatgaagcaattc
atccgctacctcatctcctccaatgtcggcgaggttgtctgcatcttcctcacggcaatt
ctgggcctgccggaagccctgatccctgtgcagctgctctgggtgaacctggtgacggat
ggcttacctgccacagccctgggtttcaacccaccagacctggacatcatggagaagctg
ccccggaaccctcgtgaggccctcatcagtggctggctcttttttcgatatctggctatt
ggagtgtacgtaggcctggccacggtggctgccgccacctggtggttcctatatgatgcc
gagggacctcacgtcaccttctaccagctgaggaacttcctgaagtgctccgaggacaac
ccactctttgctgacattgactgcgaggtcttcgagtcacgcttccccacaaccatggcc
ttgtctgtgctggtgaccattgaaatgtgcaatgccctcaacagtgtctcggagaaccag
tcgctgctgcggatgccaccctggctgaacccttggctgctggcagctgtggccatgtcc
atggccctgcacttcctcatcctgctggtgccacccctgccccttattttccaggtgacc
ccactgagtgggcgccagtgggtagtggtgctccagatatctctgcctgtcatcctgctt
gatgaggccctcaagtacctgtcccggaaccacgtggatgaagaaaaggacaagaagtga

KEGG   Felis catus (domestic cat): 493691
Entry
493691            CDS       T02385                                 
Symbol
ATP2A2
Name
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04919  Thyroid hormone signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    493691 (ATP2A2)
   04024 cAMP signaling pathway
    493691 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    493691 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    493691 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    493691 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    493691 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    493691 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493691 (ATP2A2)
   05017 Spinocerebellar ataxia
    493691 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    493691 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    493691 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    493691 (ATP2A2)
   05414 Dilated cardiomyopathy
    493691 (ATP2A2)
   05415 Diabetic cardiomyopathy
    493691 (ATP2A2)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     493691 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 493691
NCBI-ProteinID: NP_001009216
Ensembl: ENSFCAG00000028178
UniProt: Q00779
LinkDB
Position
D3:8502479..8561723
AA seq 997 aa
MENAHTKTVEEVLGYFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYKKFGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGV
KQKVMSVIREWGSGSDTLRCLALATHDNPLRREEMNLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
SPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKDDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNLTQWLMVLKISLPVILMDETLKFVARNYLEPAILE
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagacggtggaggaggtgctgggctacttcggcgtcaacgag
agcacagggctgagcctggagcaggtcaagaagctcaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgttggaacttgtgattgagcagtttgaagactta
ttagttagaattttattgctggcagcttgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccctttgtaattttacttatattagtagcc
aatgctattgtgggtgtatggcaggaaagaaatgctgagaatgctattgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtacagcggatt
aaagctaaggacatagttcctggcgatattgtagaaattgctgttggtgacaaagttcct
gctgatataagattaacttccatcaaatctactactctgagagttgaccagtccattctc
acaggtgagtctgtgtctgtcatcaagcacactgaccctgtcccagacccacgggccgtc
aaccaagataagaagaacatgctgttttctggaacaaacattgctgctggcaaagccatg
ggagtggtggtggcaactggagttaacacagaaatcggcaagatccgggatgagatggtg
gcaacagaacaggagagaacacccctccagcagaaactagacgagtttggggagcagctt
tccaaagtcatatcccttatttgcattgcagtctggatcataaacattgggcacttcaat
gacccagttcacggaggctcctggatcaggggtgctatttactactttaaaattgcggtg
gccctggctgtggcggccattcctgaaggtctgcctgctgtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccattgttcgaagtctcccttctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacgcttacgacgaaccag
atgtcagtgtgcaggatgttcattctggacaaggttgagggggatacttgttcccttaat
gagtttaccataactgggtcaacatatgcacctattggagaagtgcataaagatgataaa
ccagtgaaatgtcatcaatatgatggtcttgtggaattggcaacaatttgtgctctttgt
aatgattctgcattggattacaatgaggcgaagggcgtgtataaaaagtttggggaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaaagagcaaatgcctgcaactcggtcataaagcagttaatgaaa
aaagaatttactctcgagttttcacgcgatagaaaatcaatgtcagtttattgtacacca
aacaaaccaagccggacatcgatgagcaaaatgtttgtgaagggcgctcccgaaggtgtc
attgacaggtgcacccacattcgggttggaagtaccaaagtccctatgacccctggagtc
aaacagaaggtcatgtctgtcatcagggaatggggtagtggcagcgacacactgcggtgc
ctggctctggccactcatgacaacccactgagaagagaagaaatgaaccttgaggactct
gccaactttatcaaatatgagactaatctgactttcgttggctgtgtgggcatgctggac
cctccaagaattgaagtggcctcttctgtgaagctttgccggcaagcaggcatccgggtg
atcatgatcacaggggacaacaaaggcactgctgtggccatctgtcgccgcattggcatc
tttgggcaggacgaggatgtgacgtcaaaggcttttacgggtcgggagtttgatgagctc
agtccttcagcccagagagatgcctgcttgaatgcccgctgttttgctcgagttgagcct
tcccacaagtcaaaaattgtagagtttcttcagtcttttgatgagattacagctatgacc
ggggatggcgtgaatgatgctcccgccctgaagaaatctgagattggcattgccatgggc
tctggcacggcagtggctaaaaccgcctctgagatggtcctggccgacgacaacttctcc
accattgtggctgctgttgaggaggggcgggcgatttacaacaatatgaagcagtttatc
cgctacctcatctcttcgaatgtgggggaagttgtctgtattttcctgactgcagccctt
ggatttcctgaggctttaattcctgtccagctgctctgggtcaatctggtgacagacggc
ctgcctgccaccgcactggggtttaacccacctgatctggacatcatgaacaaaccaccc
cggaacccgaaggaaccactgatcagcggatggctctttttccgttacctagctattggc
tgttacgttggcgctgctactgtgggtgctgccgcgtggtggtttattgctgccgacggg
ggtccaagggtgtccttctaccaactgagccacttcctacagtgtaaagatgacaacccg
gactttgaaggagtggattgtgcaatctttgagtccccgtacccgatgacaatggcgctg
tctgttctagtaaccatagagatgtgtaacgccctcaacagcttgtctgaaaaccagtct
ctgctgaggatgcccccttgggagaacatctggctcgtgggctccatctgcctgtccatg
tcgctccatttcctcatcctctacgtggaacctttgccacttattttccagatcacaccg
ctgaacttgacccagtggctgatggtgctgaaaatctccttgcctgtgattctaatggat
gagacactcaagtttgtggcccgcaactacctggaacctgcaatactggagtaa

DBGET integrated database retrieval system