Felis catus (domestic cat): 101091745 Help Entry 101091745         CDS       T02385                                  Symbol CYBA Name (RefSeq) cytochrome b-245 light chain   KO K08009   cytochrome b-245, alpha polypeptide Organism fca  Felis catus (domestic cat) Pathway fca04145   Phagosome fca04380   Osteoclast differentiation fca04613   Neutrophil extracellular trap formation fca04621   NOD-like receptor signaling pathway fca04670   Leukocyte transendothelial migration fca05020   Prion disease fca05140   Leishmaniasis fca05208   Chemical carcinogenesis - reactive oxygen species fca05415   Diabetic cardiomyopathy fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101091745 (CYBA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101091745 (CYBA)    04621 NOD-like receptor signaling pathway     101091745 (CYBA)    04670 Leukocyte transendothelial migration     101091745 (CYBA)   09158 Development and regeneration    04380 Osteoclast differentiation     101091745 (CYBA)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101091745 (CYBA)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101091745 (CYBA)   09164 Neurodegenerative disease    05020 Prion disease     101091745 (CYBA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101091745 (CYBA)    05418 Fluid shear stress and atherosclerosis     101091745 (CYBA)    05415 Diabetic cardiomyopathy     101091745 (CYBA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101091745 (CYBA) Membrane trafficking [BR:fca04131]  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101091745 (CYBA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B558a DUF6030 Cg6151-P Erythrovirus_X Motif Other DBs NCBI-GeneID:  101091745 NCBI-ProteinID:  XP_006941859 UniProt:  M3W6A1 LinkDB All DBs Position E2:complement(60595817..60604566) Genome browser AA seq 194 aa AA seqDB search MGQIEWAMWANEQALASGLILVTGGIVATAGQFTSWWFGAYSIVAGVFICLLEYPRGKRR KGSTMERCGQKYLTKVVKVLGPLSRNYYIRAILHLGLSVPAGFLLATILGTACLAIASSI YLLAAFHGEQWTPIEPKPKERPQVGGTIKQPPSNPPPRPPAEARKKSNEEEAAASAGVSG GPQENPVPVVDEVV NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc cttgtcacggggggcatcgtggccactgccggccagtttaccagttggtggttcggcgcg tactccatcgtagcgggtgtcttcatctgcctgctggagtacccccgcgggaagaggaga aaggggtccaccatggagagatgcggacagaagtacctgaccaaagtggtgaaggtgttg ggacctctctccaggaactactacatccgggccatcctgcacctggggctctcggtacct gccggcttcctgcttgccaccatcctggggacagcctgcctggccatcgcgagcagcatc tatctgctggcagccttccacggagagcagtggacccccatcgagcccaagcccaaggag cggccgcaggtcgggggcaccatcaagcagccgcccagcaaccccccgccccggcccccg gccgaggcccgaaagaagtccaacgaggaggaggccgcggcatcggcaggcgtttccggc ggccctcaggagaacccggtcccggtggtcgacgaggtcgtgtga

DBGET integrated database retrieval system