KEGG   Felis catus (domestic cat): 101091759
Entry
101091759         CDS       T02385                                 
Symbol
CCL28
Name
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091759 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101091759 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101091759 (CCL28)
   04062 Chemokine signaling pathway
    101091759 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101091759 (CCL28)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101091759 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101091759
NCBI-ProteinID: XP_019667124
LinkDB
Position
A1:206943445..206969546
AA seq 279 aa
MGATNLFFDFSPALRRAAAGSPSRSWVLRASVRAAQARPQDAGGGGWSRQWPGEVPGDAE
QANAFGCPWPLPWAWSLFSSGRFSANVLLGAARTTHGLTEKPPGLASGAKSAAHAQRQEE
RRVVAPVCHNRHHPLLAAAALPPPSRPWARDPVPAPRLWLSASPASWPPRPQTPILPIAS
SCCTEVSRHVSRRLLERVNICRIQRADGDCDLAAVILHIRRRRVCVSPHSHIIKQWMKEQ
EAKKKAKGNLCHKKKQDGKRNSKGAHQGKPETHGYKTPY
NT seq 840 nt   +upstreamnt  +downstreamnt
atgggggccaccaacctgttcttcgatttctctccagctctacgaagggcagcggccggt
agcccaagccggagctgggtgctccgggcctcagtccgcgccgcccaagcgcggcctcag
gacgctgggggcggaggctggagtcgccagtggcctggggaggtcccaggcgacgccgag
caggctaacgctttcgggtgcccgtggcccctcccctgggcgtggtccttattctcctcc
ggccgcttctccgcgaacgtcctcctcggcgccgcgcgcaccacccacgggctaacagaa
aagccgccgggcctcgccagtggcgccaagtccgctgcgcacgcgcagaggcaggaggag
cggcgggttgtggctccggtatgtcacaacaggcaccacccgcttcttgctgcagccgct
ctccctcctccttctcgtccttgggctcgggatccggttccagcaccaaggctctggctc
tcggcctctcctgcttcatggccgccacgacctcagacacccatacttcccattgcctcc
agctgttgcactgaggtttcacgtcatgtttccagaaggcttctggagagagtgaatata
tgtcgcattcagagagctgatggggattgtgacttggctgctgtcatccttcacatcagg
cgcaggagggtctgcgtcagcccgcacagtcacattattaagcagtggatgaaagaacaa
gaggccaagaaaaaagctaaaggcaacctttgccacaagaagaaacaggacggcaagagg
aacagcaaaggggcacatcaggggaaacccgaaacccatggctataaaactccttattaa

DBGET integrated database retrieval system