Felis catus (domestic cat): 101091804 Help Entry 101091804         CDS       T02385                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism fca  Felis catus (domestic cat) Pathway fca04146   Peroxisome fca04213   Longevity regulating pathway - multiple species fca05012   Parkinson disease fca05014   Amyotrophic lateral sclerosis fca05016   Huntington disease fca05020   Prion disease fca05022   Pathways of neurodegeneration - multiple diseases fca05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     101091804 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     101091804 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101091804 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     101091804 (SOD1)    05014 Amyotrophic lateral sclerosis     101091804 (SOD1)    05016 Huntington disease     101091804 (SOD1)    05020 Prion disease     101091804 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     101091804 (SOD1) Enzymes [BR:fca01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      101091804 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  101091804 NCBI-ProteinID:  XP_006935984 EnsemblRapid:  ENSFCTG00005011435 LinkDB All DBs Position C2:complement(13415241..13423780) Genome browser AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGNGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVANVSMEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggagggcaccatccac ttcgtacagaagggcaatgggcctgttgtggtatcaggaaccattacaggattgactgaa ggagagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggccctcactttaatcctctatccaaaaaacatggtgggccaaaagatcaagagaggcat gttggagaccttggcaacgtaactgctggcaaggacggtgtggccaacgtgtctatggaa gattctctgattgcactctcaggagaccattccatcattggccgcacgatggtggttcac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgct gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system