Felis catus (domestic cat): 101091824 Help Entry 101091824         CDS       T02385                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism fca  Felis catus (domestic cat) Pathway fca04015   Rap1 signaling pathway fca04810   Regulation of actin cytoskeleton fca05014   Amyotrophic lateral sclerosis fca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101091824 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101091824 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101091824 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101091824 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101091824 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fca04812]     101091824 (PFN1)    04147 Exosome [BR:fca04147]     101091824 (PFN1) Membrane trafficking [BR:fca04131]  Others   Actin-binding proteins    Others     101091824 (PFN1) Cytoskeleton proteins [BR:fca04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101091824 (PFN1) Exosome [BR:fca04147]  Exosomal proteins   Proteins found in most exosomes    101091824 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101091824 NCBI-ProteinID:  XP_023099194 Ensembl:  ENSFCAG00000011175 UniProt:  M3WEL8 LinkDB All DBs Position E1:1726744..1729631 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgctctgttatccgggactcgctgctgcag gacggggaatttaccatggatctccgtaccaagagcaccggcggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcgggatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system