KEGG   Felis catus (domestic cat): 101091895
Entry
101091895         CDS       T02385                                 
Symbol
GRM5
Name
(RefSeq) metabotropic glutamate receptor 5 isoform X1
  KO
K04604  metabotropic glutamate receptor 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04072  Phospholipase D signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04540  Gap junction
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101091895 (GRM5)
   04072 Phospholipase D signaling pathway
    101091895 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101091895 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101091895 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101091895 (GRM5)
   04720 Long-term potentiation
    101091895 (GRM5)
   04723 Retrograde endocannabinoid signaling
    101091895 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091895 (GRM5)
   05016 Huntington disease
    101091895 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    101091895 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101091895 (GRM5)
G protein-coupled receptors [BR:fca04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   101091895 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Other DBs
NCBI-GeneID: 101091895
NCBI-ProteinID: XP_023095116
LinkDB
Position
D1:45990762..46515400
AA seq 1208 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQ
HRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSVG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGGAGGGAGAAGGAGGAGGGPGGPEPPDAGPKGLYDVAEAEEHFPAPARPRSPSPIST
LSQRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMMLSTTA
PGPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAAAPPAGGAARETP
TAGPEAAAGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRD
YTQSSSSL
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagttctgcttttgaaagaagatgtccgtgggagtgca
cagtccagtgaaaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttttctgttcaccatcagcccacggtggacaaagttcatgagaggaagtgtggggcagtt
cgtgaacagtatggcattcagagagtggaggccatgctgcacactctggaaaggatcaac
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggattcctgctgg
cattcggctgtggccctagagcagagcattgagttcatcagggactccctcatttcttca
gaagaagaagaaggtttggtgcgctgtgtggatgggtcttcctcttccttccgttccaag
aagcccattgtaggggtcattgggcctggctccagttctgtggccattcaggtccagaac
ttgctccagcttttcaacatacctcagattgcttactcggcaacaagcatggatctgagc
gacaagactctgttcaagtacttcatgagggttgttccttcagatgcccagcaggcacgg
gccatggtggacatagtgaagaggtacaattggacctatgtgtcagctgtgcacacagaa
ggcaactatggagaaagtgggatggaggctttcaaagatatgtcagccaaggaaggaatt
tgcatcgctcattcttacaaaatctacagcaacgcaggggaacagagtttcgataagctg
ctgaagaagctcaggagtcacttgcccaaagcccgggtggtggcctgcttctgtgagggc
atgactgtgagaggtctcctgatggccatgaggcgcctgggtctagcaggagaatttttg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggaatcacaatcaagcttcaatctcccgatgtcaagtggtttgatgattat
tatctgaagcttcggccagaaacaaaccttcgaaatccttggtttcaagaattttggcag
catcgttttcagtgccggctggaagggtttgcacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgagaacacatcacgttcaagattccaaaatgggatttgtg
atcaatgctatctattccatggcctatgggctccacaacatgcagatgtccctctgtcca
ggctatgcaggcctctgtgatgcaatgaagccaattgatggacggaaacttttggactcc
ctgatgaaaaccaattttactggggtttctggagatatgatcctatttgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgat
tatatcaatgttggaagctgggataatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaaacaacatcatcagatccgtttgcagtgaaccatgtgagaaaggccagata
aaggtgatccggaagggagaagtcagctgttgttggacctgtacaccctgtaaagagaat
gaatatgtctttgatgaatacacctgcaaggcgtgccagctggggtcgtggcccactgat
gaccttacaggttgtgatctgatcccagtacagtatcttcgctggggtgaccctgaaccc
attgccgctgttgtgtttgcctgcctcggcctgctggccaccctatttgttactgcagtc
ttcatcatttaccgtgatactccagtagtcaagtcctccagcagggaactctgctacatt
atccttgctggcatctgcctgggttacttatgtaccttctgcctcattgcaaagcccaaa
cagatttattgctaccttcagagaattggtattggtctttctccagccatgagctactca
gccctcgtaaccaagaccaatcgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccaggttcatgagtgcctgtgcccagctagtgattgctttcatcctc
atatgcattcagttgggcatcatcgttgccctctttataatggagcctcctgatataatg
cacgattacccaagcattcgtgaagtctacctgatttgtaataccaccaacctaggagtt
gtcactcctcttggatacaatggtttgctgattttgagctgtaccttctatgctttcaag
accagaaacgttccagctaacttcaatgaggccaagtacatcgccttcaccatgtacacc
acctgcatcatatggctggcctttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttttcagtcagcctcagtgccacagtggcgctgggctgcatgtttgtgcca
aaagtatacatcatcctggccaaaccggagagaaacgtgcgcagcgccttcaccacatcc
accgtggtgcgcatgcatgtgggggatggcaagtcatcctcagcagccagcaggtccagc
agcctagtcaacctgtggaagaggaggggctcctctggggaaaccctaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtgtgggc
aatggtgggagagcaaccatgagcagctccaatggcaaatccgtcacgtgggcccagaac
gagaagagcagccgggggcagcacctgtggcagcggctgtccatccacatcaacaagaaa
gagaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgcggc
ctgggcgcaggcggcgcgggcggtggcgcgggggccgcgggcggcgcggggggcgcgggc
ggcggccccggcgggccggagcccccggacgccggccccaaggggctgtacgacgtggcg
gaagcggaggagcacttccccgcgcccgcgcgcccgcgctcgccgtcgcccatcagcacg
ctgagccagcgcgcgggctccgccagccgcacggacgacgacgtgccgtcgctgcactcg
gagcccgcggcgcgcagcagctcctcgcagggctcgctcatggagcagatcagcagtgtg
gtgacccgcttcaccgccaacatcagcgagctcaactccatgatgctgtccaccacggcc
cccggccccggcgtgggcgccccgctctgctcgtcgtacctgatccccaaagagatccag
ctgcccacaaccatgacgacgttcgccgaaatccagccgctgcccgccatcgaggtcacg
ggcggcgcgcagcccgcggcggcggccccgccggctgggggcgctgctcgggagacgccg
acggccgggccggaagctgcagccggcaagccggacctggaagagctggtggctctcacc
ccgccgtcccccttcagagactcggtggactcggggagtacaacccccaactcgccagtg
tcggagtcggccctctgtatcccttcgtctcccaaatatgacacacttatcataagagat
tacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system