KEGG   Felis catus (domestic cat): 101092150
Entry
101092150         CDS       T02385                                 
Symbol
XBP1
Name
(RefSeq) LOW QUALITY PROTEIN: X-box-binding protein 1
  KO
K09027  X box-binding protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101092150 (XBP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092150 (XBP1)
   05012 Parkinson disease
    101092150 (XBP1)
   05014 Amyotrophic lateral sclerosis
    101092150 (XBP1)
   05017 Spinocerebellar ataxia
    101092150 (XBP1)
   05022 Pathways of neurodegeneration - multiple diseases
    101092150 (XBP1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101092150 (XBP1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101092150 (XBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101092150 (XBP1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101092150 (XBP1)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf KASH_CCD PPP1R26_N YabA
Other DBs
NCBI-GeneID: 101092150
NCBI-ProteinID: XP_023097382
LinkDB
Position
D3:23942443..23947331
AA seq 391 aa
MVVVASAQSPAAGAPKVLLLSGKPAAAAAAAAAGAPAGRALPLMVPGQRGASPEAASGGP
PQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLE
NQLLREKTHGLVVENQELRQRLGMDALLTEEEAETQTKGNGARPVAGSAERSTQTTCTSA
AGAGPVVTPPEHLPMDSDGVDSSDSESDILLGILFNLDPVMFFRCPSPESTSLEEQPEVY
PEGPSSLPASPSPSLGTSSAKLEAINELIRFDHVYTKPLVLEIPSETENQANVVVKIEEA
PFSPSEKDHPEFTVSVKEELVEDDFIPELGTSDLLSPSHCPKPSSCLLDAYSDCGYEGSP
SPFSDMSSLLGVDHSWEDTFANELFPQLISV
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggtggtggtggcatccgcgcagagcccggccgccggggcccccaaagtgctgcttctg
tccggcaagcccgccgccgccgccgctgccgccgccgccggagccccggccggccgggct
ctgccacttatggtgccgggccaacgaggggccagcccggaggcggcgagcggggggcca
ccccaggcgcgcaagcgacagcgcctcacgcacctgagccccgaggagaaggcgctgcgg
aggaaactgaaaaacagagtggcagctcagactgccagagaccgaaagaaagctcgaatg
agtgagctggagcagcaagtggtagatttggaggaagagaaccagaaactcttgctagaa
aatcagcttttacgagagaagacgcatggccttgtagtagagaaccaagagttaagacag
cggttggggatggatgccctgcttactgaagaggaggcagagacccagaccaaggggaat
ggagcgaggccggtggccgggtctgctgagcgcagcactcagactacgtgcacctctgca
gcaggtgcaggcccagttgtcacccctccagaacatctccccatggattctgatggtgtt
gactcttcagactctgagtctgatatcctgttgggcattctgttcaacttggatccagtc
atgttcttcagatgtccttccccagagtctaccagcctggaggaacaaccagaggtctac
ccagaaggacccagttccttaccagcctccccttctccgtcactggggacgtcatcagcc
aagctggaagccattaatgaactgattcgttttgaccacgtgtataccaagcccctcgtc
ttagagataccctctgagacagagaaccaagcaaatgtggtagtgaaaattgaggaagca
cctttcagcccctcagagaaagatcaccctgaattcactgtctcagtgaaggaagaactt
gtagaagatgacttcattccagaactgggcacctcagatctactttcacccagccactgc
ccgaagccatcttcctgtttactggatgcttatagtgactgtggatatgagggctcccct
tcccccttcagcgacatgtcctctctgcttggtgtagaccattcttgggaggacactttt
gccaatgaactctttccccagctgattagtgtctaa

DBGET integrated database retrieval system