KEGG   Felis catus (domestic cat): 101092156
Entry
101092156         CDS       T02385                                 
Symbol
KSR1
Name
(RefSeq) kinase suppressor of Ras 1 isoform X9
  KO
K14958  kinase suppressor of Ras 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101092156 (KSR1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101092156 (KSR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101092156 (KSR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092156 (KSR1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101092156 (KSR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kinase-like RIO1 C1_1 SAM_KSR1 zf-RING-like Kdo APH FTA2
Other DBs
NCBI-GeneID: 101092156
NCBI-ProteinID: XP_006940105
Ensembl: ENSFCAG00000009211
LinkDB
Position
E1:complement(18893366..19057414)
AA seq 791 aa
MNEVKVKETLRRYGANAEECGRLQYALACLRKVTGLGGEHKDDSGWSSLDARRESGSGPS
ADTLPPAGPPWPPGSTQLGRMGSGAQGPRSVSVSALPTSDSPTPGPCEGLADTCIPLHAS
GRLTPRALHSFITPPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLG
NRIDEVSPMRFDLPYGSPQMVRRDIGLSVTHRFSTKSWLSQVCHVCQKSMMFGVKCKHCR
LKCHNKCTKEAPACRISFLPQPRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPP
AMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHR
QQFIFPDISAFPQAAPSPEAADSTRLDNQPKADVLEDREGEAEETEAGKSEAEDDEDEVD
DLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRGRWHGEVAIR
LLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVR
DPKTSLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGV
VREGRRENQLKLSHDWLCYLAPEIVREMTPGKDEDQLPFSKAADVYAFGTVWYELQARDW
PFKNQAAEALIWQIGSGEGMKRVLASVSLGKEVTEILSACWAFDLQERPSFTLLMDMLEK
LPKLNRRLSHPGHFWKSAERWRSRYYGKGRYGHLDFKNSFPVLEEHINSSKVVPRFERFG
LGVLEPSNPKM
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgaacgaggtcaaggtgaaggagacgctgcggcgctacggggccaacgccgaggagtgt
ggccgcctgcagtacgccctcgcctgcctgcggaaagtgacaggtctgggaggggagcac
aaagatgactcaggctggagttcattggacgcccggcgggaaagtggctcggggccttcc
gcggacaccctcccgccagccggcccgccctggcccccagggagcacccagctgggcaga
atgggcagcggtgcccagggcccacgctccgtctccgtgtcggctctgcccacctcggac
tccccgaccccaggcccctgcgagggcctcgcggacacctgtatccccctgcacgccagc
ggccggctgaccccccgcgccctacacagcttcatcaccccgccgaccacgccccagctg
cgaaggcacaccaagctgaagccgccgcggacgccgcccccgcccagccgcaaggtcttt
cagctgctgcccagcttccccacgctcacccggagcaagtcccatgagtctcagctgggg
aaccgcattgacgaggtctccccaatgaggtttgatctcccgtacggatccccacagatg
gtacgaagggacatcgggctgtcggtgactcacaggttctccaccaagtcgtggctgtcg
caggtctgccacgtgtgccagaagagcatgatgtttggagtgaaatgcaagcactgcaga
ttgaagtgtcacaacaagtgtacaaaagaagcccctgcctgtagaatatccttccttcca
caacctaggcttcggaggacagaatctgtcccctcggacatcaacaacccggtggacaga
gcagctgagccccatttcggaaccctccccaaagcactgacaaagaaggagcaccctcca
gccatgaaccacctggactccagcagcaacccgtcctccaccacgtcctccacgccctcc
tcgccggcacccttcccgacatcgtccaatccatccagtgccacgacgccccccaacccg
tctcccggccagcgggacagcaggttcaacttcccagctgcctacttcattcatcataga
caacagtttatctttccagacatttccgcatttccgcaggcggccccgtcccctgaggca
gcagacagtacccggctcgacaaccagccaaaagcagacgtgttggaggatcgtgaaggg
gaggccgaggagacagaggccggcaagtcagaggccgaggacgacgaggacgaggtggac
gacttgccgagctcccgccggccctggcggggccccatctctcgcaaggccagccagact
agcgtgtacctgcaggagtgggacatcccctttgagcaggtggagctgggcgagcccatc
gggcagggccgctggggccgcgtgcaccgaggccgctggcacggcgaggtggccatccgc
ctgctggagatggacggccacaaccaggaccacctgaagctgttcaagaaagaggtgatg
aactaccggcagacgcggcatgagaacgtggtgctcttcatgggggcctgcatgaaccca
ccccatctggccatcatcaccagcttctgcaaaggacggacattgcactcatttgtgagg
gaccccaagacgtctctggacatcaacaagaccagacagattgctcaggagatcatcaag
ggcatgggatatctacatgccaagggcattgtgcacaaagatctcaaatccaagaacgtc
ttctatgacaacggcaaagtggtcatcacagacttcgggctgtttgggatctcgggcgtg
gtccgagagggacggcgtgagaaccagctgaagctgtcacatgactggctgtgctacttg
gccccggagattgtccgcgagatgacccccgggaaggacgaggaccagctgccgttctcc
aaagctgctgacgtctatgcatttgggactgtttggtatgaacttcaagcaagagactgg
ccctttaagaaccaagctgcagaggccttgatctggcagattggaagtggagagggaatg
aagcgcgtcctggcctccgtcagcctggggaaggaagtcactgagatcctgtctgcctgc
tgggctttcgacctgcaggagaggcccagcttcaccttgctgatggacatgctggagaaa
ctgcccaagctgaaccggcggctctcccaccccggccacttctggaagtccgctgagcgc
tggcggagccgctactacgggaaaggacgttacggccacctggactttaagaactccttt
ccggttctggaggaacacattaacagcagcaaagttgtaccccggttcgaaaggtttggc
ttgggcgtcctggagcccagtaatccaaagatgtag

DBGET integrated database retrieval system