Felis catus (domestic cat): 101092210 Help Entry 101092210         CDS       T02385                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism fca  Felis catus (domestic cat) Pathway fca04610   Complement and coagulation cascades fca04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101092210 (CD59)    04610 Complement and coagulation cascades     101092210 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101092210 (CD59)    04090 CD molecules [BR:fca04090]     101092210 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]     101092210 (CD59) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101092210 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    101092210 (CD59)   Exosomal proteins of colorectal cancer cells    101092210 (CD59) CD molecules [BR:fca04090]  Proteins   101092210 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]  Antigens   101092210 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Activin_recp KWL1 Hormone_5 Motif Other DBs NCBI-GeneID:  101092210 NCBI-ProteinID:  XP_003993199 Ensembl:  ENSFCAG00000053575 LinkDB All DBs Position D1:complement(87722186..87743335) Genome browser AA seq 126 aa AA seqDB search MITMGSQGFILLVLLLILAVLCHSGHSLTCYSCVPPVSGNCTKTSVCSSNFDSCLYIEAE PKSYYYQCWKLADCSFERISASLGLQKLQYRCCQQDLCNRSFGTTVSGKMALLVTPLLAA AWNLCL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgatcacgatgggaagccaaggattcatcctgctggtgctcctgctcatcctggccgtc ctctgccattcaggtcatagcctgacatgctacagctgtgtgccaccagtgagtggtaac tgcactaagacctccgtttgttcatcgaattttgactcgtgtctctacattgaagccgag cccaaatcctattactaccagtgctggaagttggcggactgcagtttcgagcgcatctca gcttccttggggcttcagaagctccagtaccgctgctgccagcaggacctgtgtaacagg agctttggcaccactgtctccgggaagatggctctgctggtgaccccgctgctggcagca gcctggaacctttgtctctaa

DBGET integrated database retrieval system