KEGG   Felis catus (domestic cat): 101092409
Entry
101092409         CDS       T02385                                 
Symbol
CCR10
Name
(RefSeq) C-C chemokine receptor type 10
  KO
K04185  C-C chemokine receptor type 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092409 (CCR10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101092409 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101092409 (CCR10)
   04062 Chemokine signaling pathway
    101092409 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101092409 (CCR10)
   04050 Cytokine receptors [BR:fca04050]
    101092409 (CCR10)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101092409 (CCR10)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101092409 (CCR10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 101092409
NCBI-ProteinID: XP_023100356
LinkDB
Position
E1:complement(43217130..43221216)
AA seq 363 aa
MGTEPAEQVSWSPYSGYDEEAYSAEPLPELCYKADVQAFSRAFQPSVSLAVAALGLAGNG
LVLATHLAARRAVRSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRAISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSAPGRAHVVSAIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDLALLVTGGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCSPGPRPRGRCPRRPRLSSCSAPTETHSVSS
WDY
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggggacggagcctgcagaacaggtctcctggagcccctactctgggtatgatgaggag
gcatactcggctgagccattgccagaactctgctacaaggcggatgtccaggccttcagt
cgggccttccaacccagtgtctccctggcagtggctgcactgggtctggccggcaatggc
ctggtcctggccacccacctggcagcccgacgtgctgtccgttcgcccacttctgcccac
ctgctccagctggccctggccgaccttctgctggccctaaccctgcccttcgccgcagcc
ggggctctgcagggctggagtctgggaagtgccacctgccgcgccatctcgggcctctac
tcagcctccttccacgctggcttcctcttcctggcctgtatcagcgccgaccgctatgtg
gccatcgcgcgggccctccccgctggaccgaggccctctgcgccaggccgcgcacacgtg
gtctcagccatcgtatggctgctgtcgctgcttctcgcgctgcctgctctccttttcagc
caggatgggcagcgggaaggccagcggcgctgccgtctcatctttcccgagggcctcacg
cagacggtgaagggggcaagcgccgtggcgcaggtggtcctgggcttcgcgctgccgctg
ggcgtcatggccgcctgctatgcgctcctgggccgcacgctgctggccgccagggggccc
gagcgccggcgtgcgctgcgcgtcgtggtggccctggtggcggccttcgtggtcctgcag
ctgccctacagtctcgccctgctactggatacggccgacctactggctgcccgcgagcgg
agctgccctgccagcaagcgcaaggatctggcactgctcgtgaccggagggttggccctg
gcccgctgcggcctgaaccccgtactctacgcctttttgggcctgcgattccgccaggac
ctgcggaggctgctgcggggtgggagctgcagcccagggcctcgcccccggggccgctgc
ccccgccggccccgcctctcttcctgttcggctcccactgagacccacagtgtctcctcc
tgggactactag

DBGET integrated database retrieval system