KEGG   Felis catus (domestic cat): 101092459
Entry
101092459         CDS       T02385                                 
Symbol
CXCR5
Name
(RefSeq) C-X-C chemokine receptor type 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092459 (CXCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101092459 (CXCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101092459 (CXCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101092459 (CXCR5)
   04050 Cytokine receptors [BR:fca04050]
    101092459 (CXCR5)
   04090 CD molecules [BR:fca04090]
    101092459 (CXCR5)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    101092459 (CXCR5)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CXC Chemokine
   101092459 (CXCR5)
CD molecules [BR:fca04090]
 Proteins
  101092459 (CXCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF4059 Sema4F_C
Other DBs
NCBI-GeneID: 101092459
NCBI-ProteinID: XP_003992470
Ensembl: ENSFCAG00000021975
UniProt: M3XAS4
LinkDB
Position
D1:16382279..16393991
AA seq 374 aa
MNYPLTLDMDLINYNLEDMYKELGNYSDSTESPAVENHLCSTAEGPLLSSFKAVFMPVAY
GLIFLLGMMGNILVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVIEGSVGWLLG
TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCATIWLAGI
FFALPEILFAKVSRLHRNDSLPRCTFSQENRAETNAWFTSRFLYHLGGFLLPMLVMAWCY
VGVVHRLCQAQRRPQRQKAVRVAILVTSVFFLCWSPYHVVIFLDTLARLKTVSNSCELNS
YLSVAITMSEFLGVAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQFFPTWRKS
SLSESENATSLTTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaactaccccttgaccctggacatggaccttatcaactacaacctggaggacatgtac
aaggaactaggcaactacagcgacagcacggagagccccgcggtggaaaatcacctctgc
tccacagcggaggggcccctcctgtcctccttcaaggccgtgttcatgcccgtggcctac
ggcctcatcttcctcctggggatgatgggcaacatcctggtgctggtgatcctggaacgc
caccggcaaacccgcagctccaccgagaccttcctgttccacctggccgtggccgacctc
ctcctggtcttcatcctgccttttgccgtgatcgagggctccgtgggctggctcctgggc
actttcctctgcaaaactgtgatcgccctgcacaagatcaacttctactgcagcagcctg
ctcctggcctgcatcgccgtggaccgctacctggccatcgtccacgccgtccacgcctac
cgccaccgccgcctcctctccatccacatcacctgtgccaccatctggctggcgggcatc
ttcttcgccttgccagaaatcctcttcgccaaagtgagccgcctccatcgcaacgactct
ctgccgcgctgtaccttctctcaggagaaccgagctgaaaccaacgcctggttcacctcc
cgcttcctctaccacctcgggggcttcctactgcccatgctggtgatggcctggtgctac
gtaggagtggtgcaccggctgtgccaggcccagcggcgcccgcagaggcagaaggcggtc
agggtggccatcctggtgacgagtgtcttctttctctgttggtcgccctaccacgtcgtc
atcttcctggacaccctggcgaggctgaagaccgtgagcaacagctgtgagctgaacagc
tacctctccgtggccatcaccatgagcgagttcctgggcgtggcccactgctgtctcaat
cccatgctctacacgttcgcgggcgtcaagttccgtagtgacctgtcgcgcctcctgacc
aagctgggctgtgccggccccgcctccctctgccagttcttccctacctggcgcaagagc
agtctctctgagtcagagaatgccacctccctcaccaccttctag

DBGET integrated database retrieval system