KEGG   Felis catus (domestic cat): 101092579
Entry
101092579         CDS       T02385                                 
Symbol
NLRP3
Name
(RefSeq) NACHT, LRR and PYD domains-containing protein 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04217  Necroptosis
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05164  Influenza A
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092579 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101092579 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    101092579 (NLRP3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101092579 (NLRP3)
   05164 Influenza A
    101092579 (NLRP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101092579 (NLRP3)
   05135 Yersinia infection
    101092579 (NLRP3)
   05133 Pertussis
    101092579 (NLRP3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101092579 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092579 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101092579 (NLRP3)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    101092579 (NLRP3)
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101092579 (NLRP3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN FISNA LRR_6 NOD2_WH LRR_4 NB-ARC DNA_pol3_delta AAA_16
Other DBs
NCBI-GeneID: 101092579
NCBI-ProteinID: XP_023109412
Ensembl: ENSFCAG00000009344
LinkDB
Position
A1:complement(87550307..87602820)
AA seq 1032 aa
MNMASVRCKLARYLEDLGDTDFKKFKMHLEDYPSQKGFSPLPRSQTEKADHMDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPQWDNAHVVYREESLEEEWMGLFGYLSRI
SICKKKKDYCKKYKKHVRSRFQCIKDRNARLGESVNLNKRYTRLRLVKEHKNQQEREHEL
LAIGRTSAKMLDSPVSSLNVELLFEPDDQHSEPVHTVVFQGAAGIGKTILARKIMLDWAS
EKIYQDRFDYLFYIHCREVSLGTRRSLGDLIVSCCPDPNPPICKIVSKPSRILFLMDGFD
ELQGAFDEHTEALCTNWQKVERGDILLSSLIRKRLLPEASLLITTRPVALEKLQHLLDRP
RHVEILGFSEAKRKEYFFKYFSDEQQAREAFRLIQENEILFTMCFIPLVCWIVCTGLKQQ
MDSGKSLAQTSKTTTAVYIFFLSTLLQSRRGNQNHDVSTNLRGLCSLAADGIWNQKILFE
ECDLRNHGLQKADVSAFLRINLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEGQGDTG
SLLLSGSNLPNRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQI
RLELLKWIEKKAKAKNLQIQPSQLELFYCLYEMQEEDFVQKAMGHFPQIDINLSTRMDHV
VSSFCIENCQGVESLSLRLLHNSPKEEEEEEEEEVQHCEVDHCVLLDPHAAYTHRLVNCH
LTVSLWQGLFSVLSTSWNLTELNLSDNALGDPGMMVLCEMLQRPGCNVQRLWLGRCCLSY
QCCFNISSVLSSNQKLVELDLSHNSLGDLGIRLLCVGLRHLFCNLKKLWLVSCCLTSACC
EDLASVLSTSQSLTRLYLGENALGDSGVGVLCEKAKHPQCKLQKLGLMNSGLTSGCCPAL
SSVLSTNQKLTHLYLRGNALGDTGVKLLCEGLLHPSCKLQILELDNCSLTSHCCWDLSTL
LTSNQSLRDLSLGNNDLGDLGVMLLCEVLRQQSCLLKRLKLCGMYFNYDTKCALEILQEE
KPELTIVFEPSW
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgaacatggcaagtgtccgctgcaagttggcccgttacctggaggatttgggggacaca
gactttaagaaattcaagatgcacttagaagactacccttctcaaaaggggttcagccca
ctccctcggagtcagacagagaaggcagaccacatggatctagctactttgatgattgac
ttcaatggtgaggagaaggcatgggccatggcagtgtggatttttgctgcaatcaacagg
agagacctttatgaaaaagctaagagggatgagccacagtgggataatgcacatgtggta
taccgggaagaaagccttgaagaagagtggatgggtttattcgggtacctatccagaatc
tctatttgtaaaaaaaagaaggattactgtaagaagtacaaaaaacatgtgaggagcaga
ttccagtgtatcaaagataggaatgctcgtctgggtgagagcgtgaacctcaacaaacgc
tataccaggctgcgtcttgtcaaggaacacaagaaccagcaagagagggaacatgagctc
ctggccatcggcaggacttcagccaagatgctggacagccctgtgagctccctgaatgtg
gaattactgtttgagcctgacgaccaacactctgagcctgttcacacggtggtattccag
ggagcagcaggcattgggaaaacaatactggcaaggaagatcatgttggactgggcatca
gagaaaatttaccaggacaggtttgactatttgttttatatccactgtcgggaagtgagt
ctcgggacacggaggagcctgggagacctgattgtcagctgctgcccggatccaaaccca
cccatatgcaagattgtgagcaagccttctcggattctcttcctcatggatggctttgat
gaacttcagggtgcctttgatgagcacacagaggcgctctgtacaaactggcagaaggta
gagcggggagacattctcctgagcagcctcatcagaaagaggctgcttcccgaggcctct
ttacttatcaccacgagacctgtggctctggagaaactacagcatttgctggaccggccc
cgtcatgtggagatcctgggtttctcagaggccaaaagaaaggaatactttttcaagtat
ttctcagatgagcagcaagccagggaggccttcaggctgattcaggagaatgagatcctc
ttcaccatgtgctttatccccttggtctgctggattgtgtgcaccgggttgaagcagcag
atggacagtggcaagagtcttgcccagacatccaagaccaccactgcagtgtacatcttc
ttcctctccactttgttgcaatcccgcagagggaaccagaaccacgatgtctctactaac
ctccggggtctctgttccttggccgcagatggaatctggaaccagaaaatcctgtttgag
gagtgtgaccttaggaatcatggccttcagaaggcagatgtatctgctttcttgaggatc
aacctattccagaaggaagtggactgtgagaaattctacagcttcatccacatgaccttc
caggaattctttgctgccatgtactacttgctggaagaggagggacagggagacacaggg
agcttgctgttgagtggttccaaccttcccaaccgagatgtgacagtccttctggaaaac
tatggcaagtttgaaaaggggtatctgattttcgttgtccgtttcctctttggccttgta
aaccaggagagaacctcctacttggagaaaaaactgagttgcaagatctctcagcaaatc
aggctggagctgctaaaatggattgaaaagaaagccaaggccaagaatctgcagatccag
cccagccagttggagttgttctactgtctatatgagatgcaagaggaggactttgtgcaa
aaggccatgggccatttcccccaaattgacatcaatctctctaccagaatggaccatgta
gtttcttctttttgtattgagaactgtcaaggtgtggaatcactttccctgaggttgctt
cataactctccaaaggaagaggaggaggaagaggaggaggaagtgcaacactgtgaggtg
gaccactgtgtcctcctagatcctcatgctgcctatactcaccggttggtgaactgccat
ctcactgttagcctttggcagggtctcttctcagtcctaagcactagctggaacctcacg
gaactgaacctcagtgacaatgctctgggggacccagggatgatggtgttatgtgagatg
ctccagcgtcctggctgtaatgttcagagattgtggttggggcgatgttgcctttcctat
cagtgctgcttcaacatctcctcggtcctgagcagcaatcagaagctggtagaattggat
ctgagccacaacagcttgggagatcttggaatcagacttctttgtgtgggactgaggcat
ctattctgcaatctgaagaagctctggttggtcagttgctgtctcacatcagcatgttgt
gaggacctggcatccgtcttgagcaccagccagtccctgaccagactctacttgggggaa
aatgcactgggagactcaggagttggagttctatgtgaaaaagcaaagcatccacaatgt
aagctgcagaaactggggttgatgaattctggacttacatcaggttgctgtccagctctg
tcttcagtgctcagcactaaccagaaactcacacacctttacctaaggggcaatgctctt
ggagacacgggggtgaagctactctgtgagggcctcttgcaccccagctgcaagcttcag
atattggaattggacaactgtagtctcacctcacactgttgctgggacctttccacactt
ctgacctccaaccagagcctgcgggacctgagcctaggcaacaatgaccttggtgatctg
ggggtcatgctactctgtgaggtgctgaggcagcagagctgcctcctgaaacgcctgaag
ttgtgtggaatgtatttcaattatgatacaaaatgtgcattagaaatacttcaagaagaa
aagcctgagttgaccattgtctttgagccttcttggtag

DBGET integrated database retrieval system