Felis catus (domestic cat): 101092668 Help Entry 101092668         CDS       T02385                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism fca  Felis catus (domestic cat) Pathway fca04140   Autophagy - animal fca04144   Endocytosis fca04152   AMPK signaling pathway fca04530   Tight junction fca04972   Pancreatic secretion fca05014   Amyotrophic lateral sclerosis fca05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     101092668 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101092668 (RAB8A)    04140 Autophagy - animal     101092668 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     101092668 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     101092668 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101092668 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     101092668 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101092668 (RAB8A)    03036 Chromosome and associated proteins [BR:fca03036]     101092668 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101092668 (RAB8A)    04031 GTP-binding proteins [BR:fca04031]     101092668 (RAB8A) Membrane trafficking [BR:fca04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     101092668 (RAB8A)  Autophagy   Other autophagy associated proteins     101092668 (RAB8A) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101092668 (RAB8A) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101092668 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    101092668 (RAB8A)   Exosomal proteins of colorectal cancer cells    101092668 (RAB8A) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     101092668 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  101092668 NCBI-ProteinID:  XP_003982068 LinkDB All DBs Position A2:12012168..12030545 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgcgttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgaaaaatcctttgacaacatccgg aactggattcggaatattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgcgacgtgaacgacaagagacaagtgtccaaggaacggggagagaagctcgcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaactggaaggcaac agtccccaagggagcagccagggagtcaaaatcaccccagaccagcagaagagaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system