KEGG   Felis catus (domestic cat): 101092680
Entry
101092680         CDS       T02385                                 
Symbol
FGG
Name
(RefSeq) fibrinogen gamma chain
  KO
K03905  fibrinogen gamma chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101092680 (FGG)
   04611 Platelet activation
    101092680 (FGG)
   04613 Neutrophil extracellular trap formation
    101092680 (FGG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101092680 (FGG)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101092680 (FGG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101092680 (FGG)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101092680 (FGG)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101092680 (FGG)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101092680 (FGG)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   101092680 (FGG)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Peptidase_U49 MscS_porin EzrA
Other DBs
NCBI-GeneID: 101092680
NCBI-ProteinID: XP_003984974
Ensembl: ENSFCAG00000015687
LinkDB
Position
B1:75180440..75188733
AA seq 437 aa
MTWSLNHQGLILCFCTLLLLPSTCLAYVATRDNCCILDERFGSYCPTTCGVADFLSTYQT
GVDNDLRTLEDILSRIENKTSEAKELIKSIQVNYNPNEPPKPNRIVSATKDSKKMMEEIL
KYEALIGTHESNIRFLQEIYNSNNQKINNLKLKVAQLEAKCQEPCKDTVQIHDTTGKDCQ
DIANKGAKESGLYFIKPLKAKQQFLVYCEIDGSGNGWTVLQKRLDGSLDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRIQLEDWNGRTSTADYAMFRVGPEADKY
RLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKYEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGSYSKTSTPNGYDNGIIWATWQSRWYSMKKTTMKIIPFNRLSI
GEGQQHHLGGAKQVGDI
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacttggtccttgaaccaccagggtttaatcctctgcttctgtactcttttattgctc
ccctcaacatgcctggcatatgttgctacgcgagacaactgctgcatcttagatgaaaga
tttggtagttattgcccaactacctgtggagttgcagatttcctgtctacttaccaaacc
ggtgtagacaatgatctgcggactttggaagacatcttaagtcgaattgaaaacaaaacc
tcagaagccaaagaattgatcaaatcaatccaagtcaactacaatcccaatgagccacca
aagccaaacaggatagtgagtgctactaaggattccaagaaaatgatggaagaaattcta
aaatacgaggcattaattggaacacatgaatcaaatattcgatttttgcaggaaatatat
aattcaaataaccaaaagatcaataacctgaaactgaaggtagcccagcttgaagcaaag
tgtcaggaaccatgcaaagacacagtacaaatacatgatacaactgggaaagactgtcaa
gacattgctaataagggagccaaagagagtgggctttactttatcaaacctctgaaagct
aagcagcagttcttagtctactgcgaaattgatggatctggaaatggatggactgtgttg
cagaagaggcttgatggcagtttggatttcaagaaaaattggattcaatataaagaagga
tttggacatctgtctcctactggaaccacagaattttggctgggaaatgagaagattcat
ttgataagcacccagtctgccataccatatgcattaagaatacagttggaggactggaat
ggcagaaccagtactgcagactatgccatgttcagggtgggacctgaagctgacaaatac
cgcctgacatatgcctactttattggtggagatgctggagatgcctttgacggctatgat
tttggcgatgatcctagtgataaatttttcacatcccacaatggcatgcagttcagtacc
tgggacaatgacaatgacaagtatgaaggaaattgtgctgaacaggatggatctggttgg
tggatgaacaagtgtcatgctggccacctcaatggagtttattaccaaggtggcagttac
tcaaaaacatctactcctaatggttatgataatggcattatttgggccacctggcaatcc
cggtggtattccatgaagaaaaccaccatgaagataatcccattcaacagattatctatt
ggagaaggacagcagcaccatcttgggggagccaaacaggttggagacatttga

DBGET integrated database retrieval system