KEGG   Felis catus (domestic cat): 101093054
Entry
101093054         CDS       T02385                                 
Symbol
GIT2
Name
(RefSeq) ARF GTPase-activating protein GIT2 isoform X1
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101093054 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101093054 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093054 (GIT2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    101093054 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    101093054 (GIT2)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_5 Ank_4 Ank GAS Jnk-SapK_ap_N DMPK_coil zf-RRN7 TTRAP YabA
Other DBs
NCBI-GeneID: 101093054
NCBI-ProteinID: XP_023097286
Ensembl: ENSFCAG00000011505
LinkDB
Position
D3:complement(18984600..19036779)
AA seq 761 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHVSQVRHLKHAPWPPTL
LQMVETLYNNGANSIWEHSLLDPASVMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADRRLSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVW
LATQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQ
GSPLSGSKDNVELILKTISNQHSVESQDNDQPDYDSVASDEDTDLEPTASKANRQKSLDS
DLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQ
ATTNIYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEVNHPEESR
TRLQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPND
TDPDDTGSGRKGRQRSVVWQGDGSVPDTAEPHAAPSPILPSTEDVIRKTEQITKNIQELL
RAAQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDTVRTSLRLLTSSAYRLQSECKKTL
PGDAGPPTDIQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgtcgaagcggcttcggagcagcgaggtgtgcgcggactgtagcgggccggacccttcc
tgggcatcagtaaaccgggggacttttatctgtgacgagtgctgcagcgtccaccggagc
ctggggcgccacgtctcccaagtaaggcacctgaagcacgcgccgtggcctcccacgctg
ctgcagatggttgaaaccttgtataataatggtgctaattctatatgggagcattcattg
ctggaccctgcctctgttatgagcggaagacgtaaagctaatccacaggataaagtacat
cctaataaagcagaattcatcagagccaagtatcagatgttggcgtttgtgcatcgcttg
ccttgccgggatgacgacagtgtgactgccaaagaccttagcaagcaactccattcaagc
gtgagaacagggaatctcgaaacctgtttgaggctgttatctttaggagcacaagccaac
ttctttcaccctgaaaaaggaaacaccccactccatgttgcctccaaagcagggcagatt
ttacaggcggaattattggcagtatatggagcagacccgggcacacaggattctagtgga
aaaactcctgttgattatgcaaggcaaggagggcaccatgagctggcagagcgtcttgta
gaaatacagtatgagctgactgacagactagccttctatctctgcggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagacggctcagcctggat
ttgtctgaattggcaaaagctgctaagaagaagcttcaatctctaagtaatcatttgttt
gaagaacttgccatggatgtgtacgatgaagttgacaggcgagagactgatgcagtctgg
cttgccacgcaaaaccacagcaccctggtaaccgagacaactgtcgtccccttccttccg
gtcaatcctgagtactcttcaacacggaatcagggcagacagaaactagctcggtttaac
gcccatgagtttgccacactggtcatcgacattctcagtgatgccaagaggagacagcaa
ggcagtcctctttctggttcaaaagacaacgtggagctcatactgaaaacaatcagtaac
cagcacagtgtcgagagtcaagacaacgaccagccggactatgacagtgtggcctcagat
gaagacacggatctggaacctactgcaagcaaggcaaataggcagaagagcctagattca
gatttatcagatggaccagtcactgtgcaggaatttatggaggtcaaaaacgctctagtg
gcttctgaggccaagatacaacagctaatgaaggtgaataacaacttgagtgacgagctg
agaattatgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacag
gccacaaccaatatatatcaggtgcaaactggttctgagtacacagacacttccaaccac
tcttccttaaagcgacgtccgtctgcccggggcagtaggcccatgtccatgtacgagacg
ggatcaggtcagaaaccatatctcccaatgggagaagtgaaccaccccgaagagagcagg
acgagactccagcctttccccgcgcacatcgggaggagtgcgcttgtgacctcctcttcg
tctctgccttccttcccctccacactttcctggtcgagggatgaaagcgcccgaagggca
tccaggctggagaagcagaacagcacgcctgaaagtgactatgacaacacccccaatgac
acagacccggacgacacagggtcaggcagaaaaggaaggcagaggagtgtggtgtggcaa
ggcgatggctcagtaccagatacggcagaaccccacgcagccccaagccccatcctcccc
agcacagaagacgtcatccggaaaactgaacagatcaccaaaaacatacaggagctccta
cgagcagctcaagaaaataaacacgacagttatattccctgctcagagaggatacacgta
gctgttactgaaatggcagcattattccccaaaaaacccaagtctgacacggtgaggact
tccctgcgcttgctgacgtccagcgcctaccgacttcagtcagagtgcaagaagaccctc
ccgggggacgccggcccgcccacggacatccagctggtcacacagcaggtcatccagtgc
gcgtacgacattgccaaggccgccaagcagctggtcaccatcaccaccaaagagaacaac
aactga

DBGET integrated database retrieval system