KEGG   Felis catus (domestic cat): 101093070
Entry
101093070         CDS       T02385                                 
Symbol
IL17D
Name
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04625  C-type lectin receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101093070 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101093070 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101093070 (IL17D)
   04657 IL-17 signaling pathway
    101093070 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101093070 (IL17D)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101093070 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 101093070
NCBI-ProteinID: XP_023104976
LinkDB
Position
A1:1762531..1780835
AA seq 209 aa
MARAGVWMLAVGVLLALAPGRAAGALRASRRPARPRGCAERPEELLEQLYGRLAAGVLGA
FHHTLQLGPREQARNASCPAGGRPGDRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAY
CLCRGCLTGLFGEEDLRFRSAPVYMPTVILRRTSACAGGRWVYTEEYVTVPVGCTCVPEQ
EKEADAVNSSMDKQGARLLLGPGDKPGRP
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcgcgcgggggtctggatgctggcggtcggcgttctgctggcgctggcgccgggc
cgggccgcgggcgccctgagggcgagcagacgcccggcgcggccgcggggctgcgccgag
cggcccgaggagctcctggagcagctgtacgggcggctggcggccggcgtgctgggcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgcaacgcgagctgcccggca
gggggcaggcccggcgaccggcgcttccggccgcccaccaacctgcgcagcgtgtcgccg
tgggcctacagaatttcctacgaccctgccaggtaccccaagtacctgcccgaggcctac
tgcctgtgcaggggctgcctgaccgggctcttcggggaggaggacctacgtttccggagc
gccccggtgtacatgcccaccgtcatcctgcggcggacctcggcctgcgccggcggccgc
tgggtgtacaccgaggagtacgtcaccgtgcccgtgggctgcacctgcgtccccgagcag
gagaaggaggccgacgccgtcaactccagcatggacaagcagggcgccaggcttctgctc
ggccccggcgacaagccgggccggccctga

DBGET integrated database retrieval system