KEGG   Felis catus (domestic cat): 101093152
Entry
101093152         CDS       T02385                                 
Symbol
CARD9
Name
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101093152 (CARD9)
   04625 C-type lectin receptor signaling pathway
    101093152 (CARD9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101093152 (CARD9)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101093152 (CARD9)
SSDB
Motif
Pfam: CARD CARD_2
Other DBs
NCBI-GeneID: 101093152
NCBI-ProteinID: XP_023098779
Ensembl: ENSFCAG00000007224
LinkDB
Position
D4:94696138..94706011
AA seq 772 aa
MGHGLGVPEACRHSATCRGRSCGVGTPRRGLAIARAGVRVGQARSPLWTLLQPSGDQGAC
WPSTQLRSQESDPVPSGLHLHLASRPRWFPAGPFWRSLWKLASRPDQPSWQTGLLQPREG
PCPRLGLVVPGLGLRPQRDFHFPAPRLPGPARRANQKAAPETGSLGEDLLGLRGANQHQQ
EVRGFPPGLPTAPPPVCRIRVARAGQRPTARVPLKDPEVDSRPERSRATTMSDYENEDEC
WSALESFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR
TGHKGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLMSEVLKLQRKA
QDLTQLLSSKDDLIKELRVKDSLLRKHQERVQRLKEELEAGSRELKRCKDENYELAMRLA
RQSEEKGAALMRTRDLQLEIERLKHSLMKAEDDCRVERRHTLKLRHAMEQRPSQELLWEL
QQEKALLQARVQELEAAAQEGTPDKSSPYIQVLEADWRQALREHQEKANTILSLRKDLRQ
GEALRARCVEEKEVFELQCLALRKDCEMYKDRIAAVLQQMEEVASERDQAIATREELHTQ
HSRSLQEKDALRKQVRELAEKADELQLQLFQCEGQRLALEGRLKRQQLETLVLSSDLEDS
SPRNSQDVSVNLRLSLPPDLEATRLSDKGGPANRDSPQQPPEALQEEPLPLIPNNAGLSG
GEPPEKERRRLKESFENYRRKRALRKLQHGSRQGEADWENTTGSDNTDTEGS
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggggcatggcctcggggtcccggaagcctgccgtcacagtgccacgtgtcgtggcaga
agttgtggagtggggacacccaggaggggactagctatagcgcgggctggcgtccgtgtg
gggcaggcaaggtcccctctttggacactgcttcagccctccggtgaccaaggcgcgtgc
tggcccagcacccagctgagatcccaggagtcggacccagtgccctcgggtctccacctg
cacctggccagccgcccacgctggtttccagccggccccttctggagaagcctctggaag
cttgcatccaggccagatcagcccagctggcaaaccggcctcctccagcctcgagagggc
ccttgcccacgcttgggtttagtggtgccagggttgggcctcaggccccagcgggacttc
cacttccctgcgccccgcctcccgggccctgccaggcgggcgaatcagaaggcagcccca
gagaccggctccctcggggaggacctgctcgggctccgtggagctaaccagcaccagcag
gaagtgcgcggctttcctcccgggctgccgacggcacctcctcctgtctgtcggatcagg
gtggcccgggctggccagcgtcccactgcacgggtgcccctcaaggaccctgaggtagac
agccgtccagagcgcagccgagccaccaccatgtcggactacgagaacgaggacgagtgt
tggagcgccctggagagcttccgcgtgaagctcatctcagtcatcgacccctcacgcatc
acgccctacctgcggcagtgcaaggtgctgaaccccgatgacgaggagcaggtgctcagt
gaccccaacctggtcatccgcaagcggaaagtgggcgtgctcctggacatcctgcagcgg
accggccacaagggctacgtggccttcctcgagagcctggagctctactacccgcagctg
tacaagaaggtcaccggcaaggagcccacccgtgtcttctccatgattatcgacgcatcc
ggggagtcgggcctgacgcagctgctgatgagcgaggtgctgaagctgcagaggaaggct
caggacctgacgcagctgctgagctccaaggacgacctcatcaaggagctgcgggtgaag
gacagcctgctgcgcaagcaccaggagcgcgtgcagcggctcaaggaggagctggaggcg
ggcagccgcgagctcaagcgctgcaaggacgagaactacgagctggccatgcgcctggcc
cgccagagcgaggagaagggcgccgcgctcatgcggacccgcgacctgcagctggagatt
gagcggctcaagcacagcctcatgaaggcggaggacgactgcagggtggagcgcagacac
acgctgaagctccgccacgccatggagcagcggcccagccaggagctgctgtgggagctg
cagcaggagaaggccttgctgcaggcgcgcgtgcaggagctggaggccgccgcgcaggaa
ggaacgccggacaagagcagcccgtacatccaggtgctggaggcggactggaggcaggcg
ctgcgggagcaccaggagaaagccaacaccatcctgtccctgcgcaaggatctgcgacag
ggcgaggctctgcgcgcccggtgcgtggaggagaaggaggtgttcgagctgcagtgtctg
gccctacggaaggactgcgagatgtataaggaccgcatcgcggccgtcctgcagcagatg
gaagaggtcgcctccgagagggaccaagccatcgccacgcgggaggagctgcacacacag
cactctcggagcctgcaggagaaggacgcactgcgaaagcaggtccgcgagctggccgag
aaggccgacgagttgcagctacagctgttccagtgcgagggccagcggctggccctggag
ggcaggctcaagcggcagcagctggagacgctcgtcctgagctctgacctggaggacagc
tcacccaggaactcccaggacgtgagtgtgaacctcaggctctcgctacccccggacctg
gaggccacccggctgtcagacaaaggtggccccgccaacagggacagcccacagcagccc
cctgaggctctgcaggaggaaccgcttccactgatccccaacaacgccggcctgagcggc
ggcgagcccccggagaaggagcggcggcgcctcaaggagagcttcgagaactaccgcagg
aagcgcgccctcagaaagctgcagcacggctcgaggcagggggaggcggactgggagaac
accacgggcagcgacaacaccgacacggagggctcctag

DBGET integrated database retrieval system