Felis catus (domestic cat): 101093412 Help Entry 101093412         CDS       T02385                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism fca  Felis catus (domestic cat) Pathway fca03272   Virion - Hepatitis viruses fca04382   Cornified envelope formation fca04514   Cell adhesion molecules fca04530   Tight junction fca04670   Leukocyte transendothelial migration fca05160   Hepatitis C Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     101093412 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     101093412 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101093412 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101093412 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     101093412 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     101093412 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fca03037]     101093412 (CLDN4)    04147 Exosome [BR:fca04147]     101093412 (CLDN4)    04515 Cell adhesion molecules [BR:fca04515]     101093412 (CLDN4) Cilium and associated proteins [BR:fca03037]  Other cilia and associated proteins   Stereociliary proteins    101093412 (CLDN4) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    101093412 (CLDN4)   Exosomal proteins of colorectal cancer cells    101093412 (CLDN4) Cell adhesion molecules [BR:fca04515]  Immunoglobulin superfamily   L1 family    101093412 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 DUF7139 Motif Other DBs NCBI-GeneID:  101093412 NCBI-ProteinID:  XP_006942120 UniProt:  M3W2R4 LinkDB All DBs Position E3:10301373..10303033 Genome browser AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALMVVCIILAVLGVLLSVVGGKCTNCVEDESAKAKTMIV AGVVFILAGLLVMVPVSWTANNIIRDFYNPLVASGQKREMGASLYVGWAASGLLLLGGAL LCCNCPPRTDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatgggactacaggtgatgggcatcgcgctggccgtgctgggctggctgggc gccatactgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtatacgactcgctgctggcgctgccgcaggacctgcaggcggcc cgcgccctcatggtcgtctgcatcatcctggccgtgctgggcgtgctgctgtccgtggtg ggcggcaagtgcaccaactgtgtggaggacgagagcgccaaggccaagaccatgatcgtg gcgggcgtggtgttcattctggccggcctgctggtaatggtgcccgtgtcctggacggcc aacaacatcatccgggacttctacaacccgctggtggcctccggccagaagcgggagatg ggtgcctctctgtacgtcggctgggccgcctcgggcctgctgctcctcgggggggccctg ctgtgctgcaattgccccccgcgcaccgacaagccctactcggccaagtactctgccgcc cgctccgccccggccagcaactacgtgtaa

DBGET integrated database retrieval system