KEGG   Felis catus (domestic cat): 101093500
Entry
101093500         CDS       T02385                                 
Symbol
CFD
Name
(RefSeq) complement factor D
  KO
K01334  complement factor D [EC:3.4.21.46]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101093500 (CFD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101093500 (CFD)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101093500 (CFD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101093500 (CFD)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.46  complement factor D
     101093500 (CFD)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101093500 (CFD)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 101093500
NCBI-ProteinID: XP_023098425
LinkDB
Position
A2:440131..442276
AA seq 259 aa
MTACLVHLVTLVLLGAAACAAQPRGRILGGREAESHARPYMASVQVNGKHVCGGFLVSER
WVLSAAHCVEDLADGKLQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQ
LSEKAELGPAVQPLAWQRLDRDVAAGTLCDVAGWGVVTHAGRRPDRLQQLQLRVLDRATC
NQRTYHDGTITQSMMCGESNRRDTCKGDSGGPLVCGGVAEAVVTSGSRVCGNRKKPGIYT
RLASYVAWIDGVMAEGAAA
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaccgcctgcctggtgcacctggtgacgctggtcctcctgggcgcagccgcgtgtgcg
gcgcagccccgtgggcgaatcctgggcggccgcgaggccgagtcccacgcgcggccctac
atggcgtcggtgcaggtcaacggcaagcacgtgtgcggcggcttcctggtgtccgagcgg
tgggtgctgagcgcggcgcactgcgtggaggacttggccgacgggaagctgcaggtgctc
ctgggcgcacactccctgtcgcagcccgagccctccaagcgcctgtacgacgtgctccgc
gcagtgccccacccagacagccggcccgacacaatcgaccacgacctcctcctgctgcag
ctgtcggagaaggccgagctgggccccgccgtgcagcccctggcctggcagcgcttggac
cgcgacgtggcggccggcacgctctgcgacgtggccggctggggcgtggtcacccacgcg
ggccgccggccggaccgcctgcagcaattgcaactgcgggtcctcgaccgcgccacctgc
aaccagcgcacgtaccacgacggcaccatcacccagagcatgatgtgcggggagagcaac
cgccgggacacctgcaagggcgactccgggggcccgctggtgtgcgggggcgtggccgag
gccgtggtcacgtcgggctcgcgcgtgtgcggcaaccgcaagaagcccggcatctacacg
cgcctggcgagctacgtggcctggatcgacggcgtgatggccgagggcgcggccgcttga

DBGET integrated database retrieval system