KEGG   Felis catus (domestic cat): 101093650
Entry
101093650         CDS       T02385                                 
Symbol
SMAD4
Name
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04310  Wnt signaling pathway
fca04350  TGF-beta signaling pathway
fca04371  Apelin signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04659  Th17 cell differentiation
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101093650 (SMAD4)
   04350 TGF-beta signaling pathway
    101093650 (SMAD4)
   04390 Hippo signaling pathway
    101093650 (SMAD4)
   04371 Apelin signaling pathway
    101093650 (SMAD4)
   04068 FoxO signaling pathway
    101093650 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101093650 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101093650 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    101093650 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101093650 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093650 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101093650 (SMAD4)
   05212 Pancreatic cancer
    101093650 (SMAD4)
   05225 Hepatocellular carcinoma
    101093650 (SMAD4)
   05226 Gastric cancer
    101093650 (SMAD4)
   05220 Chronic myeloid leukemia
    101093650 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093650 (SMAD4)
   05161 Hepatitis B
    101093650 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101093650 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101093650
NCBI-ProteinID: XP_011286289
Ensembl: ENSFCAG00000005257
UniProt: A0A2I2UFR8
LinkDB
Position
D3:72606228..72715739
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaagagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaactggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatatatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactcaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtaaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgaagggcagccatcattatccactgaaggtcattcaattcaa
accatccagcatccaccaagtaatcgtgcctcaacggagacatacagcaccccagctctg
ttagctccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagttggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctcgaatgtccacaggacagaagccattgaaagagcaagg
ttgcacataggcaaaggtgtgcagctggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtgcagagttactacttagacagagaagcgggccgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcggcagatgcagcagcaggcggccactgctcaagctgcagccgctgcg
caggccgccgccgtggcaggaaacatccctggccctggatcagtaggtggaatagctcca
gctatcagtttgtcagctgctgccggcattggtgtcgatgaccttcgccgtttgtgcata
ctcaggatgagttttgtgaagggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggatcgagattcacttacaccgggccctccagctcttagatgaagtgctt
cataccatgcctattgctgacccacagcctttagactga

DBGET integrated database retrieval system