Felis catus (domestic cat): 101093783 Help Entry 101093783         CDS       T02385                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism fca  Felis catus (domestic cat) Pathway fca04014   Ras signaling pathway fca04137   Mitophagy - animal fca04144   Endocytosis fca04145   Phagosome fca04148   Efferocytosis fca04962   Vasopressin-regulated water reabsorption fca05132   Salmonella infection fca05146   Amoebiasis fca05152   Tuberculosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101093783 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101093783 (RAB5B)    04145 Phagosome     101093783 (RAB5B)    04137 Mitophagy - animal     101093783 (RAB5B)    04148 Efferocytosis     101093783 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101093783 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101093783 (RAB5B)    05152 Tuberculosis     101093783 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     101093783 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101093783 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101093783 (RAB5B)    04031 GTP-binding proteins [BR:fca04031]     101093783 (RAB5B) Membrane trafficking [BR:fca04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     101093783 (RAB5B)  Endosome - Lysosome transport     101093783 (RAB5B) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101093783 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    101093783 (RAB5B)   Exosomal proteins of colorectal cancer cells    101093783 (RAB5B)   Exosomal proteins of melanoma cells    101093783 (RAB5B) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     101093783 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  101093783 NCBI-ProteinID:  XP_003988919 Ensembl:  ENSFCAG00000013974 UniProt:  M3WJU7 LinkDB All DBs Position B4:82489918..82505898 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt gtcaaagggcagtttcatgagtaccaagagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatttgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgggcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system