KEGG   Felis catus (domestic cat): 101093842
Entry
101093842         CDS       T02385                                 
Symbol
CD36
Name
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04145  Phagosome
fca04152  AMPK signaling pathway
fca04512  ECM-receptor interaction
fca04640  Hematopoietic cell lineage
fca04920  Adipocytokine signaling pathway
fca04931  Insulin resistance
fca04975  Fat digestion and absorption
fca04979  Cholesterol metabolism
fca05144  Malaria
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101093842 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101093842 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101093842 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101093842 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101093842 (CD36)
   03320 PPAR signaling pathway
    101093842 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    101093842 (CD36)
   04979 Cholesterol metabolism
    101093842 (CD36)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101093842 (CD36)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101093842 (CD36)
   05415 Diabetic cardiomyopathy
    101093842 (CD36)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101093842 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093842 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093842 (CD36)
   04090 CD molecules [BR:fca04090]
    101093842 (CD36)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101093842 (CD36)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101093842 (CD36)
CD molecules [BR:fca04090]
 Proteins
  101093842 (CD36)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 101093842
NCBI-ProteinID: XP_003982755
Ensembl: ENSFCAG00000024268
UniProt: M3WZ55
LinkDB
Position
A2:86651357..86728857
AA seq 472 aa
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIERTIKKEVVLEEGTIAYQNWVKTGTE
VYRQFWIYDVQNPQEVVANSSKIKVKQRGPYTYRVRYLAKKNITHDPETHTVSFLQPNAA
IFEPSLSAGTENDTWTVLNLAVAAAPHLYPNAFVQVVLNSLIKKSKSSMFQKRTVKELLW
GYKDPFLSLVPYPISTTVGVFFPYNNTADGVYTVFSGKDNISQVAIIDTYKGKKNLSYWP
SYCDMINGTDAASFPPFVEKTRVLRFFSSDICRSIYAVFGAEINLKGIPVYRFVLPSMAF
ASPLQNPDNHCFCTETVISNNCTSYGVLDIGRCKEGKPVYISLPHFLHASPDIAEPIEGL
TPNEDEHSTYLDVEPITGFTLRFAKRLQINILVKPAKKIEALKGLKRNYIVPILWLNETG
TIGDEKAEMFRKRVTGKINLLGLVEITLLSVGVVMFVAFMISYCACRSKKVK
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggctgtgaccgaaactgtgggctcattgctggtgctgtcattggtgcagtcctggcc
gtgtttggaggcattctaatgccagtcggagacatgcttattgagaggacaatcaaaaag
gaggttgtactcgaggaaggtaccattgcttatcaaaattgggttaaaacaggcacagaa
gtttacagacagttttggatctatgatgtgcaaaacccacaggaagtggtagctaatagc
agcaaaattaaagttaaacaaagaggtccttacacgtacagagttcgttatctagccaaa
aaaaatataacccacgatcctgagacccacacagtctcttttcttcagcccaatgcggcc
atcttcgagccttcactatcagctggaacagagaatgacacttggactgttctcaatctg
gctgtagcagctgcaccccatctctacccaaatgcatttgttcaagtggtactcaattca
cttatcaaaaagtcaaaatcttccatgtttcaaaaaagaactgtgaaagagctcttgtgg
ggctataaagatccgttcttgagtttggttccatatcctatttccacgacagttggtgtg
ttttttccttacaacaacactgcagatggagtttatacagttttcagtgggaaagacaac
atcagccaagttgccataattgacacttacaaaggtaaaaagaatctctcctattggcca
agttattgtgacatgattaatggtacagacgcagcctcatttccaccttttgttgagaag
acgcgagtgttacgtttcttttcttctgacatttgcaggtcaatctatgctgtgtttgga
gctgaaattaacctgaaaggaatccctgtctatagatttgttcttccatccatggccttt
gcatctccacttcaaaatccagataaccattgtttctgcacagaaaccgttatctccaat
aattgtacatcatatggtgtattagacattggcagatgcaaagaaggaaaacctgtgtat
atttcacttcctcattttctacatgcaagtcctgatattgcagaacccattgaaggctta
actccaaatgaagacgaacatagcacatacttagatgttgaacctataactggattcact
ttacgatttgcaaaacggctgcaaatcaacatattggtcaaaccagcaaagaaaattgag
gcattaaagggtcttaagcggaactatattgtgcctattctttggcttaatgagactggt
accattggtgatgagaaggcagaaatgtttagaaaaagagtgactggaaaaatcaacctt
cttggcctggtagaaattaccttactcagtgttggcgtggtgatgtttgttgcttttatg
atttcatactgtgcgtgcagatcaaagaaagtaaaataa

DBGET integrated database retrieval system