KEGG   Felis catus (domestic cat): 101094053
Entry
101094053         CDS       T02385                                 
Symbol
UNG
Name
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03410  Base excision repair
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101094053 (UNG)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101094053 (UNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fca03400]
    101094053 (UNG)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     101094053 (UNG)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     101094053 (UNG)
 Prokaryotic type
     101094053 (UNG)
SSDB
Motif
Pfam: UDG Toxin_ToxA PHTB1_C
Other DBs
NCBI-GeneID: 101094053
NCBI-ProteinID: XP_023097282
LinkDB
Position
D3:18284980..18295376
AA seq 313 aa
MIGQKTLYSFFSPNPAGRRRTRSPEPADPGTGVAAVAEESGDAAASPAKKARAGQEDPGT
PPTSPLSPEQLVRIQRNKAAALLRLAARNVPVGFGESWKKHLSAEFGKPYFIKLMGFVAE
ERKHYTVYPPPHQVFTWTQMCDIRHVKVVILGQDPYHGPNQAHGLCFSVQRPIPPPPSLE
NIYKELSTDIDGFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEEFTDAVVS
WLNHNSSGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELL
QKSGKEPINWKDL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgattggccagaagaccctctactccttcttctccccgaaccccgccgggagacgacgt
actcgcagccccgagccggccgacccagggaccggcgtggcggcggtagctgaggagagc
ggggatgcggcggccagccccgccaagaaggcccgggccggacaggaggaccccggcacg
ccccccacctcgccgctgagccccgaacagttggtccgcatccagaggaacaaggccgcc
gccctgctcagactcgccgcgcgcaacgtgcccgtgggtttcggtgagagttggaagaag
cacctcagcgccgagttcgggaaaccgtatttcataaagctcatgggatttgttgcagaa
gaaagaaaacattacaccgtgtatccacccccacaccaggtcttcacctggacgcaaatg
tgtgacataagacatgtgaaggttgtcatcctgggacaggatccatatcacggacccaat
caagcccacggtctctgctttagtgttcaaagacccattccacctccacccagtttggaa
aacatttataaagagctgtctacagacatagatggttttgttcatcctggtcacggagat
ttatccgggtgggccaaacaaggtgttctcttactcaacgcggtcctcaccgtccgggca
catcaggctaattcgcataaggagagaggatgggaggagtttacggatgcggtcgtgtcc
tggctaaatcacaactccagcggcctcgtcttcctgctctggggctcttacgctcagaag
aaaggcagtgccatcgataggaaacgtcaccatgtgctgcagactgctcacccctccccg
ttgtcggtgtacagagggttctttggatgtagacacttctctaaaaccaatgagttgctg
cagaagtctggcaaggagcccatcaactggaaggatctgtga

DBGET integrated database retrieval system