Felis catus (domestic cat): 101094096 Help Entry 101094096         CDS       T02385                                  Name (RefSeq) platelet factor 4-like   KO K05407   platelet factor 4 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04061   Viral protein interaction with cytokine and cytokine receptor fca04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101094096    04061 Viral protein interaction with cytokine and cytokine receptor     101094096  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101094096  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     101094096    00536 Glycosaminoglycan binding proteins [BR:fca00536]     101094096 Cytokines and neuropeptides [BR:fca04052]  Cytokines   Chemokines    101094096 Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Chemokines    101094096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101094096 NCBI-ProteinID:  XP_011280030 Ensembl:  ENSFCAG00000045931 UniProt:  A0A337SE00 LinkDB All DBs Position B1:complement(145450413..145471560) Genome browser AA seq 104 aa AA seqDB search MRLRVGAGAPRPLPSSGLLLLGLLLLPAVVALPRVDPEDEHLRCVCVKTTSEVRPKHIRS LEVMGATVHCPVPQMIASLKNGRKICLDLNAPLYKKILRKLLES NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaggcttcgagtgggtgcgggcgcccccaggcccctgcccagctcggggctcctgctc ctgggactgctgctcttgccagctgtggtcgccctccccagagtggacccagaagatgag cacctgcgctgcgtgtgcgtgaagaccacctccgaagtccgtcccaagcatatccgcagc ctggaggtgatgggtgcgacagtccactgccccgttccccagatgatagcttctctgaag aatggtaggaaaatatgcctggacctgaacgcccccctgtataagaaaatactccggaag cttttggagagctag

DBGET integrated database retrieval system