KEGG   Felis catus (domestic cat): 101094096
Entry
101094096         CDS       T02385                                 
Name
(RefSeq) platelet factor 4-like
  KO
K05407  platelet factor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094096
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094096
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101094096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094096
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101094096
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101094096
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101094096
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101094096
NCBI-ProteinID: XP_011280030
UniProt: A0A337SE00
LinkDB
Position
B1:complement(148024169..148025159)
AA seq 104 aa
MRLRVGAGAPRPLPSSGLLLLGLLLLPAVVALPRVDPEDEHLRCVCVKTTSEVRPKHIRS
LEVMGATVHCPVPQMIASLKNGRKICLDLNAPLYKKILRKLLES
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaggcttcgagtgggtgccggcgcccccaggcccctgcccagctcggggctcctgctc
ctgggactgctgctcttgccagctgtggtcgccctccccagagtggacccagaagatgag
cacctgcgctgcgtgtgcgtgaagaccacctccgaagtccgtcccaagcatatccgcagc
ctggaggtgatgggtgcgacagtccactgccccgttccccagatgatagcttctctgaag
aatggtaggaaaatatgcctggacctgaacgcccccctgtataagaaaatactccggaag
cttttggagagctag

DBGET integrated database retrieval system