KEGG   Felis catus (domestic cat): 101094122
Entry
101094122         CDS       T02385                                 
Symbol
GPC1
Name
(RefSeq) glypican-1 isoform X1
  KO
K08107  glypican 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101094122 (GPC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101094122 (GPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:fca00535]
    101094122 (GPC1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101094122 (GPC1)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   101094122 (GPC1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Others
  101094122 (GPC1)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 101094122
NCBI-ProteinID: XP_023115731
LinkDB
Position
C1:221663192..221691965
AA seq 577 aa
MGESDLPPVSPEPPGIATGRKCPTGQGKSWIWPAPLLQKPQRDRGRKEGRSPAGRWKRPW
EEGPARAGAGESSFLGEHLRICPQGYTCCTSHMEENLANRSRAELETALLDSGRALQATL
TTQLQNFDDHFQHLLNESERALQDTFPGAFGELYTQSARAFRDLYSELRLYYRGANLHLE
ETLAEFWARLLERLFRQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAA
RAFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCL
ANQADLDAEWRNLLDSMVLITDKFWGPSGAESVIGSVHLWLAEAINALQDNRDTLTAKVI
QGCGNPKVNPQSSGPEQKQRRGKLVLQERPPTGSLEKLVSEAKAQLRDAQDFWISLPGML
CSEKMAMSTASDDRCWNGMAKGRYLPEVMGDGLANQINNPEVEVDITKPDMTVRQQIMQL
KVMTNRLRSAYNGNDVDFQDASDDSSGSGSGDSCPDDLCGRRVSKKSSSPRTTLTHALPG
LSEREGQKTSASGCPRPCVSLMLLLSLVLSAARPTWR
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgggtgaatcggacctccctcccgtttccccagaacccccggggatcgccacagggagg
aagtgtcccacaggccaagggaagtcctggatatggccggccccgctgttgcaaaaaccg
caaagggaccgagggaggaaggagggacggtcaccagccggccggtggaagcgtccttgg
gaagaggggccggcgcgtgccggcgcgggcgagtcttcgtttctcggggagcacctgcgg
atctgcccccagggctacacctgctgcaccagccacatggaggagaacctggccaaccgc
agccgggctgaactggagacagccctcctggacagcggccgcgccctgcaggccacactc
accacccagctgcagaacttcgatgatcacttccagcacctgctgaacgagtcggagcgg
gcgctgcaggacaccttccccggcgccttcggggagctgtacacgcagagcgccagggcc
ttccgggacctgtactcggagctgcgcctctactaccgcggcgcaaacctgcacctggag
gagacgctggccgagttctgggcccgcctgctggagcgcctcttcaggcagctgcacccg
cagctgctgctgcccgacgactacctggactgtctgggcaagcaggccgaggcgctgcgg
cccttcggggaggccccgcgcgagctgcgcctgcgcgccacccgcgccttcgtggcagct
cgcgccttcgtgcagggcctgggcgtggccagtgacgtggtccggaaggtggcccaggtg
cccctgggcccggagtgctcgagggccgtcatgaagctggtctactgcgcgcactgcctg
ggggtccccggcgcccggccctgccctgattactgccgcaatgtgctcaaaggctgcctg
gccaaccaggccgacctcgacgccgagtggaggaaccttctggactccatggtgctcatc
accgacaagttctggggcccgtcgggtgcggaaagcgtcatcggcagtgtgcatttgtgg
ctcgcagaagccatcaacgccctccaggacaacagggatacgctcacagccaaggtcatc
cagggctgtgggaaccccaaggtgaacccccagagctctgggcctgagcagaagcagcgc
cggggcaagctggtgctacaggagaggccccccacgggctcactggagaagctggtctcc
gaggccaaagcacagctccgagatgcccaggacttctggatcagcctcccggggatgctg
tgcagcgagaagatggccatgagcaccgccagtgacgaccgctgctggaacggcatggcc
aagggccggtacctcccggaagtgatgggtgatggcctggccaatcagatcaacaaccct
gaggtggaggtggacatcaccaagcccgacatgacggtccgccaacagatcatgcagctg
aaggtcatgaccaaccggcttcgcagcgcctacaatggcaacgacgtggacttccaggac
gccagtgacgacagcagtggctcgggcagcggggatagctgccccgacgacctctgtggc
cggagagtcagcaagaaaagctccagcccacggacgaccctgacccacgccctcccgggc
ctgtcagagcgggagggccagaagacctccgcctccggctgcccccggccctgcgtgtcc
ctaatgctgctcctctccctggtcctctcggccgccaggcccacgtggcggtaa

DBGET integrated database retrieval system