KEGG   Felis catus (domestic cat): 101094190
Entry
101094190         CDS       T02385                                 
Symbol
WNT1
Name
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101094190 (WNT1)
   04390 Hippo signaling pathway
    101094190 (WNT1)
   04150 mTOR signaling pathway
    101094190 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101094190 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101094190 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094190 (WNT1)
   05205 Proteoglycans in cancer
    101094190 (WNT1)
   05207 Chemical carcinogenesis - receptor activation
    101094190 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101094190 (WNT1)
   05226 Gastric cancer
    101094190 (WNT1)
   05217 Basal cell carcinoma
    101094190 (WNT1)
   05224 Breast cancer
    101094190 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101094190 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094190 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    101094190 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094190 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101094190 (WNT1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Morphogens
   101094190 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 101094190
NCBI-ProteinID: XP_023112780
Ensembl: ENSFCAG00000000089
LinkDB
Position
B4:77975931..77981871
AA seq 370 aa
MGHWALLPGWVSATLWLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTATGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcccggctgggtttctgctacgctgtggctggcgctggcc
gctctgcccgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgactccaagagtctacaactggtgctcgagcccagt
cttcagctgctgagccgcaaacagaggaggctgatccgccagaacccggggatcctgcac
agcgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccgcaaccgc
cgctggaactgccccacggctacggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacggcgtttattttcgctatcacctccgccggggttacccattcggtggcg
cgctcctgctcagagggctccatcgagtcttgcacgtgcgactatcggcggcgcggccct
gggggccccgattggcactgggggggctgcagcgacaacatcgacttcggccgcctcttc
ggcagggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggctggccgcacgactgtgttctctgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgattcgatggcgcctcgcgcgtcctctatggcaac
cgcggcagcaaccgcgcctcgagggcggaactgctgcgcctggagcccgaggacccggcg
cacaagccgccctccccccacgacctcgtctacttcgagaaatcgcccaatttctgcacg
tacagcggacgcctgggaacggcgggcacggccgggcgcgcctgcaacagctcctcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgtacgcgcacacagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

DBGET integrated database retrieval system