KEGG   Felis catus (domestic cat): 101094344
Entry
101094344         CDS       T02385                                 
Name
(RefSeq) platelet basic protein
  KO
K10029  platelet basic protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094344
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094344
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101094344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094344
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101094344
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101094344
NCBI-ProteinID: XP_003985378
Ensembl: ENSFCAG00000022486
LinkDB
Position
B1:complement(148029686..148031499)
AA seq 115 aa
MGLSPTSSCSSTSRLPVLPGLLLLSLFLSTLVPSGLTKRADVEPFVELRCLCMKTVSGIH
PSNIQNLEVLRAGPHCANVEVIATLKNGNKVCLDPEAPKIKKIVQKILESGGSMA
NT seq 348 nt   +upstreamnt  +downstreamnt
atgggcctcagtcctacctcctcctgctccagcaccagccggcttccggtcctaccgggc
ttgctactgctgtcgctgttcctgagcacgctggttccctctgggttaactaaacgtgca
gacgtggagccgttcgttgaacttcgctgcctgtgtatgaaaaccgtctctggcattcac
ccaagtaacatccagaatttggaggtgctcagggcaggaccccactgtgccaacgtcgaa
gtgatagccacgctgaagaacgggaacaaagtctgcctggacccagaagctcccaaaatc
aagaaaatagtccagaaaattttggaaagtggtgggtcaatggcttaa

DBGET integrated database retrieval system