KEGG   Felis catus (domestic cat): 101094391
Entry
101094391         CDS       T02385                                 
Symbol
IL34
Name
(RefSeq) interleukin-34 isoform X1
  KO
K22633  interleukin 34
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094391 (IL34)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094391 (IL34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094391 (IL34)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101094391 (IL34)
SSDB
Motif
Pfam: IL34
Other DBs
NCBI-GeneID: 101094391
NCBI-ProteinID: XP_006941782
Ensembl: ENSFCAG00000028376
LinkDB
Position
E2:complement(50749276..50832493)
AA seq 236 aa
MPRGFAWLHYLGIFLAMALGNEGLEMWPLTQSEECAVTGFLRDKLQYRNRLQYMKHYFPI
NYRVSVPYEGVLRMANITRLQRAQVSQQELRYLWVWVSLSATESVQEVLLEGHPSWKFLE
EVHTLLLDVQQGLTDVEVSPKVEAVVSLLSTPRLSLKLVRPKALLDNCFRVMELLYCSCC
KQSSVLNWQDCEVPSPQPHSPEPSSQCVAAPLYPLPQQPPISLPRSPGPKTGPPAQ
NT seq 711 nt   +upstreamnt  +downstreamnt
atgccccggggattcgcctggctgcactatctcgggatcttccttgccatggccttgggg
aacgagggtttggagatgtggcctttgacccagagcgaggagtgtgcagtaactggcttt
cttcgggacaagcttcagtacaggaaccgccttcagtacatgaaacactacttccccatc
aactacagggtgagcgtgccttatgagggggtgctcagaatggccaacatcaccagactg
cagagggcccaggtcagccagcaggagctgcggtatctgtgggtctgggtgagcctcagt
gctactgagtcggtgcaggaagtgctgcttgagggccacccatcctggaagttcctggag
gaggtacatacgctgctgctggatgttcagcaaggcctcacggatgtggaggtcagcccc
aaggtggaagcagtggtgtcgctcctgagcacccccaggttgagcctgaagctggtacga
cccaaagccctgctggacaactgcttccgggtcatggaactgctctactgctcttgctgt
aaacaaagttccgtcctaaattggcaggactgtgaggtgccgagccctcagccccacagc
ccggagccctcatcgcagtgtgtagctgccccgctgtaccctctgccccagcagcccccc
atctccctgccccgctccccaggacccaagactggacccccggctcagtga

DBGET integrated database retrieval system