KEGG   Felis catus (domestic cat): 101094593
Entry
101094593         CDS       T02385                                 
Symbol
CXCL6
Name
(RefSeq) C-X-C motif chemokine 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05133  Pertussis
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101094593 (CXCL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094593 (CXCL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094593 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101094593 (CXCL6)
   04062 Chemokine signaling pathway
    101094593 (CXCL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    101094593 (CXCL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101094593 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094593 (CXCL6)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101094593 (CXCL6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101094593
NCBI-ProteinID: XP_003985379
UniProt: M3WLP6
LinkDB
Position
B1:complement(148040188..148042387)
AA seq 148 aa
MRRTWGSHSARELQIRAPLPPLEPAPLAALVAAMSLPPSRAARAPRLSGSLCALLLLLLL
LLTPPGPLASAGPVAVIVRELRCVCLTTTPGIHPKMIAKMQVIGAGPQCPKVEVIATLKN
KKEVCLDPETPVMKKAIQKILDSGKKAD
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcggagaacttggggaagccacagtgcgagggagcttcaaatccgggctcctctcccg
cctctggaacccgcacccctcgccgcactcgtggccgccatgagcctcccgccgagccgc
gccgcccgcgccccgcgcctttcgggctcgctgtgcgcgctgctcctgctgctgctgctg
ctgctgacgccgccggggcccctcgccagcgccggtcccgtcgcggtcatagtgagggag
ctgcgttgcgtgtgtttaaccaccacaccggggattcatcccaaaatgatcgctaagatg
caggtgatcggggccgggccacagtgtcccaaggtggaagtcatagccaccctgaagaac
aagaaggaagtctgtctggacccagaaacccctgtgatgaagaaagccatccagaaaatc
ttagacagtgggaaaaaggctgattaa

DBGET integrated database retrieval system