Felis catus (domestic cat): 101094619 Help Entry 101094619         CDS       T02385                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism fca  Felis catus (domestic cat) Pathway fca03272   Virion - Hepatitis viruses fca04382   Cornified envelope formation fca04514   Cell adhesion molecule (CAM) interaction fca04530   Tight junction fca04670   Leukocyte transendothelial migration fca05160   Hepatitis C Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     101094619 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     101094619 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101094619 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101094619 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     101094619 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     101094619 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fca03037]     101094619 (CLDN1)    04147 Exosome [BR:fca04147]     101094619 (CLDN1) Cilium and associated proteins [BR:fca03037]  Other cilia and associated proteins   Stereociliary proteins    101094619 (CLDN1) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    101094619 (CLDN1)   Exosomal proteins of colorectal cancer cells    101094619 (CLDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 SUR7 Voltage_CLC DUF7937 Cytochrom_B_C TMEM174 HAAS_TM DUF6336 DUF6594 DUF6479 Motif Other DBs NCBI-GeneID:  101094619 NCBI-ProteinID:  XP_003991843 UniProt:  A0ABI7YYJ7 LinkDB All DBs Position C2:77623865..77640262 Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAV IGGVTFLIAGLAVLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctgttaggcttcatcctggccttcctgggctggatcggc tccatcgtcagcacggcactgccccaatggaagatttactcctacgccggcgacaacatc gtgactgcccaggccatctacgaggggctgtggatgtcttgcgtgtcacagagcaccggg cagatacagtgcaaagtcttcgactccttgctgaatctgaacagcactttgcaagcaacc cgcgctttgatggtgattggcatccttctgggacttatagccatctttgtggccactgtt ggcatgaagtgcatgaagtgcatggaagacgatgaggtgcagaagatgcggatggctgtc attgggggtgtgacatttctcattgcaggtctggctgttttagttgccacagcatggtat ggcaatagaattgttcaagaattttatgatcccatgaccccggtcaatgccaggtatgaa tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctactttgctgttcctgtccccggaaaacaacatcttacccaacgccacggccttatcca aaacctgcaccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system