KEGG   Felis catus (domestic cat): 101094641
Entry
101094641         CDS       T02385                                 
Symbol
CYLD
Name
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD isoform X1
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101094641 (CYLD)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101094641 (CYLD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101094641 (CYLD)
   04625 C-type lectin receptor signaling pathway
    101094641 (CYLD)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101094641 (CYLD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101094641 (CYLD)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101094641 (CYLD)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101094641 (CYLD)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C67
   101094641 (CYLD)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101094641 (CYLD)
SSDB
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Other DBs
NCBI-GeneID: 101094641
NCBI-ProteinID: XP_023100658
LinkDB
Position
E2:30780475..30846490
AA seq 956 aa
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFQCDEDCGVFVALDKLEILEDDDNGLESDYAGPGDTVQMELPPLEINSRVSLKL
GETTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVADKGSSSHNKPKATGPTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISSDFGHASPPLQPPSMNSLSTENRFHSLP
FSLTKMPNANGSIGHSPLSLSVQSVMGELNNAPVQESPPLAMASGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGNIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacgcaaaagctccttaaa
gtaccaaaggggagtataggacagtatatccaagatcgttctgtggggcactcgaggatt
ccgtctgcaaaaggcaagaaaaatcagattggattaaaaatcctagagcaaccacacgcg
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaaaaacagaaacagactgagt
aaaggcctccagatagatgtgggctgccctgtgaaagtacagctgagatccggggaagaa
aaatttcctggagttgtgcgcttcagaggacccttattagcagagaggacagtatcggga
atattctttggagtagaactactggaagaaggccgtggccaaggttttactgacgggata
tatcaagggaaacagcttttccagtgtgatgaagactgtggagtgtttgttgcgttggac
aagctagaaatcctggaagatgatgacaatggattggaaagtgattatgcaggtccaggg
gacaccgtgcagatggaacttccgcccctggagataaactccagagtttctttgaagctt
ggagaaaccacagagtccggcacagttatattctgcgacgtcttgcctgggaaagaaagc
ttaggatattttgtcggtgtggacatggataatcctattggcaactgggatggaagattt
gatggggtgcaactttgtagtttcgcaagtgttgaaagtacaattctcttgcatatcaat
gatatcatcccagctttatcagatagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttgcggacaaaggttcatccagtcataataaaccaaaggctaca
ggacctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatgga
tcttctgttgactcacaaccacaatccaaatcaaaaaacacatggtacattgatgaagtt
gctgaagaccccgcaaagtcgcttacagagatatcttcagactttggacatgcttcacca
ccactgcaacctccttccatgaactcattatctaccgagaacagatttcactctttacca
ttcagtctgaccaagatgcccaatgccaatggaagcattggccacagcccgctttctctg
tcagttcagtctgtaatgggagagctaaacaatgcccctgtccaggagagtccacccttg
gccatggcttctgggaactcccatggtctggaagtgggctcactggctgaagttaaagag
aatcctcctttctatggggtaattcgttggatcggtcagccgccaggactcaacgaagtg
ctagctggactggaactggaagatgaatgtgcgggctgtacagacggaacctttaggggc
acacggtacttcacttgtgccctgaagaaggcgctgtttgttaagctgaagagctgcagg
cccgactcgagatttgcatccctgcagccagtttccaatcagatcgaacgctgtaactcg
ctggcattcggaggctacttgagtgaagtagtggaagaaaataccccacccaaaatggaa
aaagaaggtttagagataatgattggaaagaagaagggtatccagggtcattacaattct
tgttacttagactcaaccttattctgcttgtttgcttttagttctgtcctggacactgtg
ctacttagacctaaagaaaagaatgatgtagaatattatagtgaaacgcaagagctactg
aggacggaaatcgtgaatcctctgagaatatacggatatgtgtgtgcaacaaagattatg
aaactgaggaaaatacttgaaaaagttgaggctgcatcaggatttacctcggaagaaaaa
gatcctgaagagttcttgaatatcctgtttcatcatattttaagggtagaaccattgtta
aaaataaggtcagcaggtcaaaaagtgcaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggagttcctacaattcagcaattgttagaatggtcttttatcaac
agtaacctgaagtttgcagaggcaccatcatgtctcattattcagatgcctcgatttgga
aaagactttaaactgtttaaaaaaatttttccttccctggaattaaatataaccgattta
cttgaagacacccccaggcagtgccggatctgcggggggctcgccatgtacgagtgtaga
gagtgttatgatgatcccgacatctcagccggaaacatcaagcagttttgtaaaacctgc
aacacccaagtccacctccatcccaagagactgaaccataaatacaacccagtgtcgctt
cccaaagatttacccgactgggactggaggcacggctgcatcccctgccagaagatggaa
ctgtttgctgtcctctgcatagaaacgagccactatgttgcttttgtgaagtacgggaag
gacgactctgcctggctcttctttgacagcatggccgatcgagatggtggtcagaatggc
ttcaacattcctcaggttaccccatgcccggaagtaggagagtacttgaaaatgtctccg
gaagacctacactccttggactccagaagaatccaaggctgtgcgcgaagacttctctgt
gatgcgtacatgtgcatgtaccagagtccaacaatgagtctgtacaaataa

DBGET integrated database retrieval system