KEGG   Felis catus (domestic cat): 101094739
Entry
101094739         CDS       T02385                                 
Symbol
GPC3
Name
(RefSeq) glypican-3 isoform X1
  KO
K08109  glypican 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101094739 (GPC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:fca00535]
    101094739 (GPC3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101094739 (GPC3)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   101094739 (GPC3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Others
  101094739 (GPC3)
SSDB
Motif
Pfam: Glypican DAOA
Other DBs
NCBI-GeneID: 101094739
NCBI-ProteinID: XP_023105153
Ensembl: ENSFCAG00000006864
LinkDB
Position
X:complement(112443529..112865784)
AA seq 580 aa
MAGTVRTACLVVAMLLGLDCPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNIEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNDLFDSLFPVIYT
QLMSPGLPESTSDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGVYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYVCSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPK
GRVLDKTLDEEGLESGDCGDDEDECIGGSGDGTTKVRNQLRFLAELAYDLDVDDAPGNKQ
HVNQKDNEIAASHNLGSGRFPLKVLTSLAICVAWFFFPVH
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggcggggaccgtgcgcaccgcgtgcttggtggtggcgatgctgctcggcttggactgc
cccggacaggcgcagcccccgccgccgccgccggacgccacctgtcaccaggtccgctcc
ttcttccagagactgcagcccggactcaagtgggtgcccgaaacccccgtgccaggatca
gatctgcaagtatgtctccccaagggcccaacatgctgctcaagaaagatggaagaaaaa
taccaactaacggcccgcctgaacatcgaacagctgcttcagtctgcaagtatggagctc
aagttcttaattattcagaatgctgcggttttccaagaggcctttgaaattgttgttcgc
cacgccaagaattacaccaacgccatgtttaagaacaactatccgagcctgaccccgcaa
gcttttgagtttgtgggtgaatttttcaccgacgtgtctctctatatcctgggttctgac
atcaatgtggacgacatggtcaatgatttgtttgacagcctgtttccggtcatctatacc
cagctcatgagccccggcctgcctgagtcgacctcggacatcaacgagtgcctccgaggg
gcaaggcgtgacctgaaagtctttgggaatttccccaagcttattatgacccaggtttcc
aagtcgctgcaggtcacccggatcttcctccaggccctgaatctcggaattgaggtgatc
aacacaactgatcatctgaagttcagtaaagactgtggccggatgctcaccaggatgtgg
tactgctcttactgccagggactgatgatggttaagccttgcggtggctactgcaatgtg
gtcatgcaaggctgtatggcaggcgtggtggagattgacaagtactggagagaatacatt
ctgtctctggaagaactggtgaatggcgtatacagaatctacgacatggagaatgtgctg
cttgggctcttttcaacgatccacgattccatccaatatgtccagaagaatggaggaaag
ctgaccaccaccattggcaagttatgtgcccattctcaacagcgccaatatagatctgct
tattatcctgaagatctgtttattgacaagaaggtattaaaagttgctcatgtagaacat
gaagaaaccttatccagccgaagaagggaactaattcagaagttgaaatctttcatcagc
ttctacagtgctttgcctggctacgtctgcagccacagtcctgtggctgaaaacgacact
ctttgctggaatggacaagaactcgtggagagatatagccagaaggcagcgaggaatggc
atgaaaaatcagttcaacctccacgagctgaaaatgaagggccccgagccagtggtcagt
caaatcattgacaaactgaagcacattaaccagctcctgaggaccatgtctgtgcccaaa
ggtagagttctggataaaacccttgacgaggaagggcttgaaagtggcgactgtggcgac
gatgaagacgagtgcatcgggggctcgggggacggcaccacaaaagtgaggaaccagctc
cgcttccttgcagaactggcttatgatctggatgtggatgatgctcctggaaacaagcag
cacgtgaatcagaaggacaatgagatagcggcctcgcacaacctggggagcggccgcttc
cccctgaaggttctaaccagcttggcgatctgtgtggcgtggtttttcttcccggtgcac
tga

DBGET integrated database retrieval system