KEGG   Felis catus (domestic cat): 101094773
Entry
101094773         CDS       T02385                                 
Symbol
C1QC
Name
(RefSeq) complement C1q subcomponent subunit C
  KO
K03988  complement C1q subcomponent subunit C
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04936  Alcoholic liver disease
fca05020  Prion disease
fca05133  Pertussis
fca05142  Chagas disease
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101094773 (C1QC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101094773 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101094773 (C1QC)
   05150 Staphylococcus aureus infection
    101094773 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101094773 (C1QC)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101094773 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion disease
    101094773 (C1QC)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101094773 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094773 (C1QC)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101094773 (C1QC)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 101094773
NCBI-ProteinID: XP_019691924
LinkDB
Position
C1:16786537..16791055
AA seq 245 aa
MDTVSSSRPPLGLNLLVLLLVLPLGGQASTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGTQGPKGQKGERGTPGHPGKNGPTGTAGSPGVPGLMGPPGEPGEEGRYKQKHQS
VFTVTRQTSQYPTANSLVKFNVAITNPQGDYDTSTGKFTCRVPGLYYFVYHTSQTANLCV
LLYRSGVRVTTFCDHLSNRKQVSSGGVLLQLQAGEQVWLAVNDYNGMVGTEGSDSVFSGF
LLFPD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacacggtgtccagctcccggcccccccttggactaaacctgctggtgctcttgctg
gtgctgccacttgggggccaggccagcacgggctgctacgggatccccgggatgccaggc
ctgccgggggccccagggaaggacggatacgatggcctgccggggcccaagggtgagcca
ggaatcccagctatccctggaactcaaggacccaagggtcagaagggagaacgcggcaca
cctgggcatcccgggaaaaatggccccacgggaacggctggtagtccaggggttcccggc
ctcatgggaccccctggggagccgggcgaggagggcagatacaagcagaagcaccagtct
gtcttcacggtcacacggcagacatcccagtaccccacggccaacagcctggtcaagttc
aacgtagccatcaccaacccgcagggcgattatgacacaagcaccggcaagttcacctgc
agagtcccgggtctttactactttgtgtaccacacgtcgcagacggccaacctgtgcgtg
ctgctgtaccggagtggtgtcagggtgaccaccttctgtgaccacctgtccaacaggaag
caggtcagctcgggcggtgtgctgctgcagctgcaggcgggtgagcaggtgtggctggcg
gtcaatgactacaacggcatggtgggcaccgaaggctcggacagcgtcttctctggcttc
ctgctctttcctgactag

KEGG   Felis catus (domestic cat): 101096082
Entry
101096082         CDS       T02385                                 
Symbol
C1QA
Name
(RefSeq) complement C1q subcomponent subunit A
  KO
K03986  complement C1q subcomponent subunit A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04936  Alcoholic liver disease
fca05020  Prion disease
fca05133  Pertussis
fca05142  Chagas disease
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101096082 (C1QA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101096082 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101096082 (C1QA)
   05150 Staphylococcus aureus infection
    101096082 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101096082 (C1QA)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101096082 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion disease
    101096082 (C1QA)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101096082 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096082 (C1QA)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101096082 (C1QA)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 101096082
NCBI-ProteinID: XP_006934451
Ensembl: ENSFCAG00000030671
UniProt: M3WS63
LinkDB
Position
C1:16779945..16783226
AA seq 245 aa
MEAPWGWLVVCVLATFLTFTVTQDVCRAPDGKAGAPGAPGRPGRPGLKGEQGEPGAPGVR
TGIQGLKGDQGDPGPPGNPGNMGFPGPSGSLGLPGIPGVKGIKGNPGNIKDQPRPAFSAI
RRNPPMSGNIVIFDTVVTNQEGPYHNNTGQFICAVSGYYYFTFQVVSKWDICLSIVSSGR
DQAQRSLGFCDANGKGIFQMVSGSTVLKLQRGDRVWIERDPAQGRIYQGPEVDSVFSGFL
VFPSI
NT seq 738 nt   +upstreamnt  +downstreamnt
atggaggccccatggggctggctggtggtctgcgtgctggccacattcctgacctttaca
gtgacccaggatgtgtgccgagcaccagatgggaaggctggggccccaggagcgcctggc
cgacccggacggccaggcctcaagggggagcaaggggagccaggggcacctggcgtccgg
acgggcatccagggccttaaaggagaccagggggaccctgggccccctggaaaccctggc
aacatgggcttccctgggcccagtggctccctgggtctccctggcatcccgggagtgaaa
ggcatcaagggcaacccgggcaacatcaaggaccagccacggccagccttctcggccatc
aggcggaacccaccaatgagtggcaacatcgtcatcttcgacacggtcgtcaccaaccag
gaaggcccgtaccacaataacacggggcagttcatctgtgctgtgtccggctactactac
ttcactttccaggtggtgtccaagtgggacatctgcctgtccatcgtgtcctctgggagg
gaccaggcccagcgctccttgggcttctgtgacgccaacggcaagggaatcttccagatg
gtgtccgggagcacggttctcaagttacagcgtggtgatcgggtctggatcgaaagagac
cccgcccagggccggatttaccagggccctgaggtggacagcgtcttcagtggcttcctc
gtcttcccatccatctga

KEGG   Felis catus (domestic cat): 101096331
Entry
101096331         CDS       T02385                                 
Symbol
C1QB
Name
(RefSeq) complement C1q subcomponent subunit B
  KO
K03987  complement C1q subcomponent subunit B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04936  Alcoholic liver disease
fca05020  Prion disease
fca05133  Pertussis
fca05142  Chagas disease
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101096331 (C1QB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101096331 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101096331 (C1QB)
   05150 Staphylococcus aureus infection
    101096331 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101096331 (C1QB)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101096331 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    101096331 (C1QB)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101096331 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096331 (C1QB)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101096331 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 101096331
NCBI-ProteinID: XP_003989691
Ensembl: ENSFCAG00000000543
UniProt: A0A3B0IPC1
LinkDB
Position
C1:16795270..16800354
AA seq 254 aa
MKTVRDGVLASLLLLLLLFLFLLEVSWAQSSCTGHPAIPGIPGIPGAPGSPGTPGTPGTK
GEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPVGPKGSPGPPGARGPKGESGDYKAT
QKIAFCAKRTINSALRRDQAIRFDQVITNLNNNYESRSGKFTCRVPGIYYFTYHASSRGN
LCVNLMRGREQMQKVVTFCDYVHNTFQVSTGSMVLKLKQGENVFLQATDKNSLVGIEGAN
SIFSGFLLFPDVEA
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaagaccgtgagggatggcgtcttagcatccctgctgctgctgctgctgctgttcctg
tttctgcttgaggtctcttgggcccaaagcagctgcaccgggcacccggccatccccggc
atcccgggcattcccggggcaccgggctctcctggtacacccgggaccccagggacaaaa
ggagagaaagggctgccagggctggctggagaccatggcgagtttggggagaagggagac
ccagggattcctgggaatccaggaaaagtaggccccaagggccccgttggccccaaaggt
tccccagggccccccggagcccgcggccccaagggtgaatcaggagactacaaggccaca
cagaaaatcgccttctgtgccaagaggaccatcaacagtgcccttcggcgggaccaggcc
atccgcttcgaccaggtgatcaccaacctgaacaacaactacgaatctcgaagcggcaag
ttcacctgcagggtgcccggcatttactacttcacctaccatgccagctcgcgaggaaac
ctctgcgtgaacctcatgcggggccgggagcaaatgcagaaggtggttaccttctgcgac
tacgtccacaacaccttccaggtctccacgggcagcatggtcctcaagctgaagcagggg
gagaacgtcttcctgcaggccactgacaagaactccctggtgggcatagaaggtgccaac
agcatcttctctgggttcctgctcttcccagatgtggaggcatga

DBGET integrated database retrieval system