KEGG   Felis catus (domestic cat): 101094859
Entry
101094859         CDS       T02385                                 
Symbol
CLEC4E
Name
(RefSeq) C-type lectin domain family 4 member E
  KO
K10059  C-type lectin domain family 4 member E
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101094859 (CLEC4E)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101094859 (CLEC4E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101094859 (CLEC4E)
   04091 Lectins [BR:fca04091]
    101094859 (CLEC4E)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101094859 (CLEC4E)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    101094859 (CLEC4E)
SSDB
Motif
Pfam: Lectin_C BsuPI CoV_E
Other DBs
NCBI-GeneID: 101094859
NCBI-ProteinID: XP_003988419
Ensembl: ENSFCAG00000012908
LinkDB
Position
B4:42625173..42631187
AA seq 228 aa
MTEGERERERMNSSQPSTSQGTEKGRFSSQRLLWTVAGVSILLLSVCFITRCVVTYHSFQ
LCDEKKFQPYEDLMDFSCYKDVSGSVKNCCPLSWIHFQSSCYLFSTNTMSWASSVKNCSN
MGAHLVVINTQEEQEFLFYAKPKRREFYIGLTDQVTEGQWQWIDGTPFTEALSFWDEGEP
NNIVTVEDCATIRDSSNPRKNWNDVPCFFNVFRICEMPEISALNNKKI
NT seq 687 nt   +upstreamnt  +downstreamnt
atgacagaaggagagagagagagagagagaatgaattcatcccaaccatctacatcacaa
ggcacagagaaaggacgcttctcttcccaaaggctcttatggactgttgctggggtctcc
attctactgctcagtgtctgttttatcaccagatgtgttgtgacgtatcatagctttcaa
ctctgtgatgagaaaaagttccagccatatgaggatttaatggacttctcctgctacaaa
gatgtatcgggttcagtcaagaattgttgtccgttgagctggatccattttcaatctagc
tgctacttattttctactaacaccatgtcctgggcatcaagcgtaaaaaactgctcaaac
atgggagcacatctggtcgttatcaacacacaggaggagcaggaatttcttttctacgcg
aaaccgaaaaggagagagttttatattggactgacagaccaggtgactgagggtcagtgg
caatggatagacggcacacctttcacagaagctctgagcttctgggacgaaggggagccc
aataatatagttacagtggaggactgtgctaccatacgagactcttcaaatccgaggaaa
aattggaacgacgtgccctgtttcttcaatgtgtttcggatttgtgaaatgcctgaaata
agtgctttgaataacaaaaaaatctga

DBGET integrated database retrieval system