Felis catus (domestic cat): 101094966 Help Entry 101094966         CDS       T02385                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism fca  Felis catus (domestic cat) Pathway fca04014   Ras signaling pathway fca04137   Mitophagy - animal fca04144   Endocytosis fca04145   Phagosome fca04148   Efferocytosis fca04962   Vasopressin-regulated water reabsorption fca05132   Salmonella infection fca05146   Amoebiasis fca05152   Tuberculosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101094966 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101094966 (RAB5C)    04145 Phagosome     101094966 (RAB5C)    04137 Mitophagy - animal     101094966 (RAB5C)    04148 Efferocytosis     101094966 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101094966 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101094966 (RAB5C)    05152 Tuberculosis     101094966 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     101094966 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101094966 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101094966 (RAB5C)    04031 GTP-binding proteins [BR:fca04031]     101094966 (RAB5C) Membrane trafficking [BR:fca04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     101094966 (RAB5C)  Endosome - Lysosome transport     101094966 (RAB5C) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101094966 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    101094966 (RAB5C)   Exosomal proteins of colorectal cancer cells    101094966 (RAB5C)   Exosomal proteins of bladder cancer cells    101094966 (RAB5C) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     101094966 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  101094966 NCBI-ProteinID:  XP_003996927 Ensembl:  ENSFCAG00000002148 UniProt:  M3VXZ7 LinkDB All DBs Position E1:complement(40800436..40823893) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaacggaccagccgctgggaacaagatctgt cagtttaagctggtcctgctcggggagtctgcagtgggcaaatccagcctcgtgctccgc tttgtcaagggacagttccatgagtaccaggagagcaccattggagcggccttcctcaca cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaagctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggctagccccaacatcgtcatcgcacttgcagggaacaaggcggacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcggaagacaacagtctgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcagctggtgctccaggccggaaccgaggcgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system