KEGG   Felis catus (domestic cat): 101095016
Entry
101095016         CDS       T02385                                 
Symbol
STX7
Name
(RefSeq) syntaxin-7 isoform X1
  KO
K08488  syntaxin 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04130  SNARE interactions in vesicular transport
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    101095016 (STX7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101095016 (STX7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095016 (STX7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101095016 (STX7)
Membrane trafficking [BR:fca04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    101095016 (STX7)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101095016 (STX7)
SSDB
Motif
Pfam: Syntaxin_2 SNARE Syntaxin Prominin GAS DUF6033 DUF5345 Cep57_CLD_2
Other DBs
NCBI-GeneID: 101095016
NCBI-ProteinID: XP_006932078
Ensembl: ENSFCAG00000002292
UniProt: A0A2I2UJ09
LinkDB
Position
B2:complement(122365937..122410066)
AA seq 261 aa
MSYTPGVGGDPALLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAQFTTSLTNFQKVQREAAEKEKEFVA
RVRASSRVSGGFPEDTSKERNLVSWESQAQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAAEYQRKSRKTLCI
IIFIIVIGLVILGLIIWRVKG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttacactccgggtgttggtggtgaccctgccctactggcccagcgtatctcttcc
aatatccagaagatcacacaatgttctgtggaaatacagaggaccctgaatcaacttgga
acgcctcaagattcacctgaacttaggcaacaactgcaacagaagcagcagtatactaac
caacttgccaaagagacagataagtacattaaagagtttggatccctgcccaccaccccc
agcgaacagcgtcagaggaaaatacaaaaggatcgcttagtggctcaattcacgacatca
ctgacaaactttcaaaaggtccagagggaagctgctgagaaagagaaagagtttgttgct
cgagtaagagccagttccagagtatctggtggttttcctgaggacacctcaaaggaaagg
aatcttgtatcctgggaaagccaagctcaacctcaggtgcaggtgcaggatgaagaaatt
acagaagatgacctccgccttattcatgagagagaatcttctattaggcaacttgaggct
gatattatggatattaatgaaatatttaaagatttgggaatgatgattcacgagcaagga
gatgtaatagatagcatagaagccaacgtggaaaatgcggaggtgcacgttcagcaagca
aaccagcagctgtcaagagcagcagaatatcagcgcaaatccagaaaaaccctgtgcatc
atcatttttatcattgtcatcggacttgtaattctcggtctcatcatatggagagtgaaa
ggctga

DBGET integrated database retrieval system