KEGG   Felis catus (domestic cat): 101095156
Entry
101095156         CDS       T02385                                 
Symbol
ELK1
Name
(RefSeq) ETS domain-containing protein Elk-1 isoform X1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04510  Focal adhesion
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca05140  Leishmaniasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05213  Endometrial cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101095156 (ELK1)
   04012 ErbB signaling pathway
    101095156 (ELK1)
   04014 Ras signaling pathway
    101095156 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101095156 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101095156 (ELK1)
   04912 GnRH signaling pathway
    101095156 (ELK1)
   04921 Oxytocin signaling pathway
    101095156 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095156 (ELK1)
   05205 Proteoglycans in cancer
    101095156 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101095156 (ELK1)
   05213 Endometrial cancer
    101095156 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095156 (ELK1)
   05161 Hepatitis B
    101095156 (ELK1)
   05163 Human cytomegalovirus infection
    101095156 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101095156 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095156 (ELK1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101095156 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 101095156
NCBI-ProteinID: XP_006943739
Ensembl: ENSFCAG00000008192
UniProt: M3W951
LinkDB
Position
X:complement(42066948..42081506)
AA seq 435 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVARCSTEDCPPQPEVSITSTVANVAPTAVH
TVPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPPHSRPA
SVLSNTAPAGAAVPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAQNPKSEEMNVDP
GLGRPLPPEVKVDGPKEEVEATVGGEAGFVQEAAKAGPEVPPAEGGPARLPAVVMETTAQ
VGGLAASTASNTEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALT
PSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVD
GLSTPVVLSPGPQKP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggacccctctgtgacgctgtggcagtttctgctgcagctgctgagagaacaaggcaac
ggccacatcatctcctggacctcccgggatggcggtgagttcaagctggtggatgccgag
gaggtggcccggctgtgggggctgcgtaagaacaagaccaacatgaattacgacaagctc
agccgggccctgcggtactactacgacaagaacatcatccgcaaagtgagcggccagaag
ttcgtctacaagtttgtgtcctaccccgaggtcgcgaggtgctccactgaggactgcccg
ccccagcctgaggtgtcgatcacctccactgtggcaaatgtggcccccaccgctgtacac
actgtccccggggacacagcctctgggaaaccaggcacacccaagggtgcaggcatggca
ggcccgggtggcttggcgcgcagcagccggaacgagtacatgcgctcaggcctctattcc
accttcaccatccagtccctgcagccacagccacagccgccccctcattctcggcctgcc
tcagtgctctccaacaccgcccctgcaggagctgcagtgcccccttctgggagcaggagc
accagtccaagccccctggaggcctgcctggaggctgaggaggctggcctgcctctgcag
gtcatcctgaccccacccgaggcccagaaccctaaatcagaagagatgaatgtggatccc
gggttgggcaggccactgccccccgaagtgaaagtggacgggcccaaggaagaggtggaa
gccactgtcggtggggaggcggggtttgtgcaggaagccgctaaggccgggccggaagtt
cctcctgcggagggtgggccggcccggctgcccgcggtcgtcatggagacaacagcgcag
gtcggcggtctcgcggcttccactgcttccaacacggagatcgcccagcctcagaagggc
cggaagccccgggacctggagcttccactcagcccgagcctgctgggtgggccaggaccc
gagcggactccaggatcgggaactggctccgggctgcaggcgccggggccagcgctgacc
ccgtccctgctacctacgcacacattgaccccggtgctgctgacgccaagctcgctgccc
cccagcattcacttctggagcaccctgagtcccattgcaccccgtagcccagccaagctc
tccttccagtttccgtccagtggcagcgcccaggtgcacatcccttccatcagcgtggat
ggcctctcaacccccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system